Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Gastrotropin  

UniProtKB / Swiss-Prot ID :  FABP6_HUMAN

Gene Name (Synonyms) : 
FABP6, ILBP, ILLBP  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform 1: Cytoplasm. Isoform 2: Cytoplasm. Note=Localized close to nucleus on the apical side of both normal and neoplastic cells. 

Protein Function :  Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis. 

Protein Sequence MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKES...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
33R -> H (in dbSNP:rs17856662). VAR_039578
55S -> Y (in dbSNP:rs17852045). VAR_039579
79T -> M (in dbSNP:rs1130435). VAR_039580
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NR1H4_HUMANENSP00000312283STRING
NTCP2_HUMANENSP00000312283STRING
MRP3_HUMANENSP00000312283STRING
ALBU_HUMANENSP00000312283STRING
ALBU_HUMANENSP00000312283STRING
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures