Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, heart  

UniProtKB / Swiss-Prot ID :  FABPH_HUMAN

Gene Name (Synonyms) : 
FABP3, FABP11, MDGI  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. 

Protein Sequence MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE...
Predicted Secondary Structure CCCCCCEEEEEEEECCHHHHHHHHCCCHHHHHHHHHCCCEEEEEEECCEEEEEEECCCCEEEEEEEEEEE...
Protein Variant
LocationDescription
53K -> R (in dbSNP:rs2228194). VAR_061165
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylvaline.---MVDAFL
---CCCCCC
7.96UniProtKB
Link
20PhosphotyrosineNFDDYMKSL
CHHHHHHHH
14.32HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TNI3K_HUMANphysical interactionEBI-704227
intact12721663
VPS28_HUMANyeast 2-hybridHPRD:00613HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Characterization and amino acid sequence of a fatty acid-bindingprotein from human heart.";
Offner G.D., Brecher P., Sawlivich W.B., Costello C.E., Troxler R.F.;
Biochem. J. 252:191-198(1988).
Cited for: PROTEIN SEQUENCE OF 2-133.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures