Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, intestinal  

UniProtKB / Swiss-Prot ID :  FABPI_RAT

Gene Name (Synonyms) : 
Fabp2, Fabpi  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor (By similarity). 

Protein Sequence MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFA...
Predicted Secondary Structure CCCEEEEEEEEECCHHHHHHHHCCCHHHHHHHHHCCCEEEEEEECCEEEEEEECCCCEEEEEEEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAFDGT
---CCCEEE
15.96UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Cloning of a cDNA encoding rat intestinal fatty acid bindingprotein.";
Alpers D.H., Strauss A.W., Ockner R.K., Bass N.M., Gordon J.I.;
Proc. Natl. Acad. Sci. U.S.A. 81:313-317(1984).
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures