Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid-binding protein, liver  

UniProtKB / Swiss-Prot ID :  FABPL_RHASA

Gene Name (Synonyms) : 
fabp1  

Species :  Rhamdia sapo (South American catfish). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport this L-FABP binds only one fatty acid/molecule. Has more affinity for trans-parinaric acid than for cis-parinaric acid. 

Protein Sequence MAFSGTWQVYAQENYEEFLRAISLPEDVIKLAKDVKPVTEIQQTGNDFVITSKTPGKSVTNSFTIGKEAE...
Predicted Secondary Structure CCCEEEEEEEEECCHHHHHHHHCCCHHHHHHHHHCCCEEEEEEECCEEEEEEECCCCEEEEEEEECEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAFSGT
---CCCEEE
13.81UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino acid sequence, binding properties and evolutionaryrelationships of the basic liver fatty-acid-binding protein from thecatfish Rhamdia sapo.";
Di Pietro S.M., Dell'Angelica E.C., Veerkamp J.H., Sterin-Speziale N.,Santome J.A.;
Eur. J. Biochem. 249:510-517(1997).
Cited for: PROTEIN SEQUENCE OF 2-126, AND ACETYLATION AT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures