Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fatty acid synthase  

UniProtKB / Swiss-Prot ID :  FAS_HUMAN

Gene Name (Synonyms) : 
FASN, FAS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. 

Protein Function :  Fatty acid synthetase catalyzes the formation of long- chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein. 

Protein Sequence MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRFDASFFGVHPK...
Predicted Secondary Structure CCCEEEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHCCCHH...
Protein Variant
LocationDescription
1483V -> I (in dbSNP:rs2228305). VAR_055479
1694R -> H (in dbSNP:rs2229424). VAR_055480
1888I -> V (in dbSNP:rs2228307). VAR_055481
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylmethionine.----MEEVV
----CCCEE
43.05UniProtKB
Link-
41Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DRRWKAGLY
CCCCCCCCC
30.66Phosphositeplus
Link-
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GVHPKQAHT
CCCHHHHHH
45.28Phosphositeplus
Link-
70N6-acetyllysineGVHPKQAHT
CCCHHHHHH
45.28HPRD
Link-
70N6-acetyllysineGVHPKQAHT
CCCHHHHHH
45.28Phosphositeplus
Link-
70N6-acetyllysine.GVHPKQAHT
CCCHHHHHH
45.28UniProtKB
Link-
207PhosphoserineLGMLSPEGT
CCCCCCCCC
16.41HPRD
Link-
207PhosphoserineLGMLSPEGT
CCCCCCCCC
16.41PhosphoELM
Link-
207PhosphoserineLGMLSPEGT
CCCCCCCCC
16.41Phosphositeplus
Link-
207PhosphoserineLGMLSPEGT
CCCCCCCCC
16.41SysPTM
Link-
207Phosphoserine.LGMLSPEGT
CCCCCCCCC
16.41UniProtKB
Link-
213Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EGTCKAFDT
CCCCCCCCC
52.50Phosphositeplus
Link-
217PhosphothreonineKAFDTAGNG
CCCCCCCCE
29.97HPRD
Link-
222PhosphotyrosineAGNGYCRSE
CCCEEEEEC
6.68HPRD
Link-
222PhosphotyrosineAGNGYCRSE
CCCEEEEEC
6.68Phosphositeplus
Link-
235Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VLLTKKSLA
EEECCHHHH
40.09Phosphositeplus
Link-
245PhosphothreonineRVYATILNA
CCCEEEEEE
14.33HPRD
Link-
251PhosphothreonineLNAGTNTDG
EEEEECCCC
32.32HPRD
Link-
253PhosphothreonineAGTNTDGFK
EEECCCCCC
37.02HPRD
Link-
257Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TDGFKEQGV
CCCCCCCCC
55.44Phosphositeplus
Link-
298Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GTGTKVGDP
CCCCCHHHH
45.63Phosphositeplus
Link-
298N6-acetyllysineGTGTKVGDP
CCCCCHHHH
45.63HPRD
Link-
298N6-acetyllysineGTGTKVGDP
CCCCCHHHH
45.63Phosphositeplus
Link-
298N6-acetyllysine.GTGTKVGDP
CCCCCHHHH
45.63UniProtKB
Link-
326Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IGSTKSNMG
EECHHHHHC
41.34Phosphositeplus
Link-
436Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAVQKLLEQ
HHHHHHHHH
48.73Phosphositeplus
Link-
436N6-acetyllysineEAVQKLLEQ
HHHHHHHHH
48.73HPRD
Link-
436N6-acetyllysineEAVQKLLEQ
HHHHHHHHH
48.73Phosphositeplus
Link-
436N6-acetyllysine.EAVQKLLEQ
HHHHHHHHH
48.73UniProtKB
Link-
528Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DEAVKPFGL
HHHHHHHCC
41.50Phosphositeplus
Link-
528N6-acetyllysineDEAVKPFGL
HHHHHHHCC
41.50HPRD
Link-
528N6-acetyllysineDEAVKPFGL
HHHHHHHCC
41.50Phosphositeplus
Link-
528N6-acetyllysine.DEAVKPFGL
HHHHHHHCC
41.50UniProtKB
Link-
634S-nitrosocysteineCKQRCPPGV
HHHHCCCCE
4.40dbSNO
Link-
642S-nitrosocysteineVVPACHNSK
EEEEEEECC
2.27dbSNO
Link-
667Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EQLRKEGVF
HHHHHCCCC
68.37Phosphositeplus
Link-
673Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GVFAKEVRT
CCCEEECCC
45.32Phosphositeplus
Link-
673N6-acetyllysineGVFAKEVRT
CCCEEECCC
45.32HPRD
Link-
673N6-acetyllysineGVFAKEVRT
CCCEEECCC
45.32Phosphositeplus
Link-
673N6-acetyllysine.GVFAKEVRT
CCCEEECCC
45.32UniProtKB
Link-
724PhosphoserineAQWHSSLAR
CCCCCCHHH
24.88HPRD
Link-
725PhosphoserineQWHSSLART
CCCCCHHHH
17.11HPRD
Link-
974PhosphoserineDHPESPTPN
CCCCCCCCC
38.23HPRD
Link-
974PhosphoserineDHPESPTPN
CCCCCCCCC
38.23PhosphoELM
Link-
976PhosphothreoninePESPTPNPT
CCCCCCCCC
45.00HPRD
Link-
976PhosphothreoninePESPTPNPT
CCCCCCCCC
45.00PhosphoELM
Link-
976PhosphothreoninePESPTPNPT
CCCCCCCCC
45.00Phosphositeplus
Link-
992Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AEVYKELRL
HHHHHHHHH
56.29Phosphositeplus
Link-
1047PhosphotyrosineKHGLYLPTR
CCCEECCEE
18.41Phosphositeplus
Link-
1065Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)THRQKLYTL
CCCEEEEEE
43.34Phosphositeplus
Link-
1072Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLQDKAQVA
EECCCCCHH
27.97Phosphositeplus
Link-
1118S-nitrosocysteineLEKFCFTPH
HHHHEECCC
5.71dbSNO
Link-
1127S-nitrosocysteineTEEGCLSER
CCHHHHHHH
4.23dbSNO
Link-
1158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QQGLKMVVP
HCCCEEEEE
36.15Phosphositeplus
Link-
1393Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VGLKKSFYG
EEEHHHHHH
51.33Phosphositeplus
Link-
1411PhosphoserineTPQDSPIFL
CCCCCCEEE
18.04HPRD
Link-
1411PhosphoserineTPQDSPIFL
CCCCCCEEE
18.04PhosphoELM
Link-
1429Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VESLKGILA
HHHHHHHHC
53.86Phosphositeplus
Link-
1471S-nitrosocysteineNRLRCVLLS
CEEEEEEEE
2.75dbSNO
Link-
1471S-nitrosocysteineNRLRCVLLS
CEEEEEEEE
2.75HPRD
Link-
1523Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEEDKPEEP
CCCCCCCCC
58.57Phosphositeplus
Link-
1582Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LATGKLSPD
HHCCCCCCC
41.24Phosphositeplus
Link-
1591Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AIPGKWTSQ
CCCCCCEEE
41.78Phosphositeplus
Link-
1593PhosphothreoninePGKWTSQDS
CCCCEEEEE
21.72HPRD
Link-
1594PhosphoserineGKWTSQDSL
CCCEEEEEE
30.76HPRD
Link-
1704Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSAEKRAYL
CCCHHHHHH
41.88Phosphositeplus
Link-
1704N6-acetyllysineGSAEKRAYL
CCCHHHHHH
41.88HPRD
Link-
1704N6-acetyllysineGSAEKRAYL
CCCHHHHHH
41.88Phosphositeplus
Link-
1704N6-acetyllysine.GSAEKRAYL
CCCHHHHHH
41.88UniProtKB
Link-
1739Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HTGGKGVDL
HHCCCCCEE
58.04Phosphositeplus
Link-
1752Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAEEKLQAS
CCHHHHHHH
37.09Phosphositeplus
Link-
1752N6-acetyllysineLAEEKLQAS
CCHHHHHHH
37.09HPRD
Link-
1752N6-acetyllysineLAEEKLQAS
CCHHHHHHH
37.09Phosphositeplus
Link-
1752N6-acetyllysine.LAEEKLQAS
CCHHHHHHH
37.09UniProtKB
Link-
1771N6-acetyllysineLEIGKFDLS
EEEECCCCC
41.17HPRD
Link-
1771N6-acetyllysineLEIGKFDLS
EEEECCCCC
41.17Phosphositeplus
Link-
1771N6-acetyllysine.LEIGKFDLS
EEEECCCCC
41.17UniProtKB
Link-
1847Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MAQGKHIGK
HHHCCCEEE
21.70Phosphositeplus
Link-
1847N6-acetyllysineMAQGKHIGK
HHHCCCEEE
21.70HPRD
Link-
1847N6-acetyllysineMAQGKHIGK
HHHCCCEEE
21.70Phosphositeplus
Link-
1847N6-acetyllysine.MAQGKHIGK
HHHCCCEEE
21.70UniProtKB
Link-
1851Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KHIGKVVVQ
CCEEEEEEC
31.11Phosphositeplus
Link-
1866Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAVLKGAKP
CCCCCCCCC
50.66Phosphositeplus
Link-
1869Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKGAKPKLM
CCCCCCCCC
51.89Phosphositeplus
Link-
1878Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SAISKTFCP
CCCCCCCCC
39.24Phosphositeplus
Link-
1911Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RGVQKLVLT
CCCCEEEEE
37.85Phosphositeplus
Link-
1927Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GYQAKQVRR
HHHHHHHHH
33.53Phosphositeplus
Link-
1993Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QDVCKPKYS
HHHHHHHHH
44.38Phosphositeplus
Link-
1995N6-acetyllysineVCKPKYSGT
HHHHHHHHH
37.23HPRD
Link-
1995N6-acetyllysineVCKPKYSGT
HHHHHHHHH
37.23Phosphositeplus
Link-
1995N6-acetyllysine.VCKPKYSGT
HHHHHHHHH
37.23UniProtKB
Link-
2047Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RICEKRRHE
HHHHHHHHH
50.77Phosphositeplus
Link-
2123PhosphoserineRDRDSQRDL
CCCHHHHHH
28.19HPRD
Link-
2123PhosphoserineRDRDSQRDL
CCCHHHHHH
28.19Phosphositeplus
Link-
2186Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LTLRKLQEL
HHHHHHHHH
58.60Phosphositeplus
Link-
2198PhosphoserineADEASELAC
CCCCCCCCC
30.97HPRD
Link-
2198PhosphoserineADEASELAC
CCCCCCCCC
30.97PhosphoELM
Link-
2198PhosphoserineADEASELAC
CCCCCCCCC
30.97Phosphositeplus
Link-
2198PhosphoserineADEASELAC
CCCCCCCCC
30.97SysPTM
Link-
2198Phosphoserine.ADEASELAC
CCCCCCCCC
30.97UniProtKB
Link-
2204PhosphothreonineLACPTPKED
CCCCCCCCC
47.04HPRD
Link-
2204PhosphothreonineLACPTPKED
CCCCCCCCC
47.04PhosphoELM
Link-
2204PhosphothreonineLACPTPKED
CCCCCCCCC
47.04Phosphositeplus
Link-
2204PhosphothreonineLACPTPKED
CCCCCCCCC
47.04SysPTM
Link-
2204Phosphothreonine.LACPTPKED
CCCCCCCCC
47.04UniProtKB
Link-
2236PhosphoserineMRLNSVQSS
HHCCCCCCC
26.56HPRD
Link
2236PhosphoserineMRLNSVQSS
HHCCCCCCC
26.56PhosphoELM
Link
2236PhosphoserineMRLNSVQSS
HHCCCCCCC
26.56Phosphositeplus
Link
2236PhosphoserineMRLNSVQSS
HHCCCCCCC
26.56SysPTM
Link
2236Phosphoserine.MRLNSVQSS
HHCCCCCCC
26.56UniProtKB
Link
2391Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LLPLKGLEE
HCCCCCHHH
60.55Phosphositeplus
Link
2436Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QYTPKAKYH
CCCCCCCCC
50.11Phosphositeplus
Link
2439PhosphotyrosinePKAKYHGNV
CCCCCCCCE
21.59Phosphositeplus
Link
2449Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LLRAKTGGA
EEEECCCCC
41.07Phosphositeplus
Link
2483PhosphothreonineGDHRTLLEG
CCCCCCCCC
32.07HPRD
Link
2488PhosphoserineLLEGSGLES
CCCCCCHHH
30.72HPRD
Link
2499PhosphoserineSIIHSSLAE
HHHHHHHCC
19.35HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
M3K3_HUMANphysical interactionMINT-48440MINT14743216
NEMO_HUMANphysical interactionMINT-48192MINT14743216
FAS_HUMANin vitro
yeast 2-hybrid
HPRD:02567HPRD11248039
INS_HUMANENSP00000304592STRING
INS_HUMANENSP00000304592STRING
ACLY_HUMANENSP00000304592STRING
SRBP1_HUMANENSP00000304592STRING
SRBP1_HUMANENSP00000304592STRING
SRBP1_HUMANENSP00000304592STRING
SRBP1_HUMANENSP00000304592STRING
DCMC_HUMANENSP00000304592STRING
OXSM_HUMANENSP00000304592STRING
FABD_HUMANENSP00000304592STRING
CISY_HUMANENSP00000304592STRING
ACACA_HUMANENSP00000304592STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB01034Cerulenin
DB01083Orlistat
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-207 AND THR-2204, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-70; LYS-298; LYS-436;LYS-528; LYS-673; LYS-1704; LYS-1752; LYS-1771; LYS-1847 AND LYS-1995,AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Large-scale characterization of HeLa cell nuclear phosphoproteins.";
Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J.,Li J., Cohn M.A., Cantley L.C., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2204, AND MASSSPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2204, AND MASSSPECTROMETRY.
"A probability-based approach for high-throughput proteinphosphorylation analysis and site localization.";
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.;
Nat. Biotechnol. 24:1285-1292(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2204, AND MASSSPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-207; SER-2198; THR-2204AND SER-2236, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-207 AND THR-2204, AND MASS SPECTROMETRY.
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2204, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures