Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Immunoglobulin alpha Fc receptor  

UniProtKB / Swiss-Prot ID :  FCAR_HUMAN

Gene Name (Synonyms) : 
FCAR, CD89  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform A.1: Cell membrane; Single-pass type I membrane protein. Isoform A.2: Cell membrane; Single-pass type I membrane protein. Isoform A.3: Cell membrane; Single-pass type I membrane protein. Isoform B: Secreted. Isoform B-delta-S2: Secreted. 

Protein Function :  Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production. 

Transmembrane Topology (topPTM) : FCAR_HUMAN 

Protein Sequence MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE...
Predicted Secondary Structure CCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCEECCCCCCEEEEEEECCCCCEEEEEEEECCCCCC...
Protein Variant
LocationDescription
113D -> N (in dbSNP:rs11666735). VAR_049996
269S -> G (in dbSNP:rs16986050). VAR_049997
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
56PhosphotyrosineIREAYLTQL
CCCCCEEEE
12.91HPRD
Link
56PhosphotyrosineIREAYLTQL
CCCCCEEEE
12.91PhosphoELM
Link
56PhosphotyrosineIREAYLTQL
CCCCCEEEE
12.91Phosphositeplus
Link
56Phosphotyrosine.IREAYLTQL
CCCCCEEEE
12.91UniProtKB
Link
223Nitrated tyrosine.IHQDYTTQN
CCCCCCCCC
12.71UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
IGHA1_HUMANdirect interactionEBI-1036536
intact12768205
CD79A_HUMANin vivoHPRD:00914HPRD10438530
8666916
FCGR1_HUMANin vivoHPRD:00914HPRD8530370
12524384
FCAR_HUMANin vitroHPRD:00914HPRD12634059
12768205
PILRA_HUMANin vitroHPRD:00914HPRD15085135
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Nitration
ReferencePubMed
"The human pituitary nitroproteome: detection of nitrotyrosyl-proteinswith two-dimensional Western blotting, and amino acid sequencedetermination with mass spectrometry.";
Zhan X., Desiderio D.M.;
Biochem. Biophys. Res. Commun. 325:1180-1186(2004).
Cited for: NITRATION [LARGE SCALE ANALYSIS] AT TYR-223, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-56, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures