Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  GDP-L-fucose synthase  

UniProtKB / Swiss-Prot ID :  FCL_HUMAN

Gene Name (Synonyms) : 
TSTA3, SDR4E1  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Two step NADP-dependent conversion of GDP-4-dehydro-6- deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction. 

Protein Sequence MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA...
Predicted Secondary Structure CCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
13PhosphothreonineRILVTGGSG
EEEEECCCC
32.17HPRD
Link-
13PhosphothreonineRILVTGGSG
EEEEECCCC
32.17Phosphositeplus
Link-
21Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLVGKAIQK
CHHHHHHHH
34.53Phosphositeplus
Link
44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FVSSKDADL
CCCCCCCCC
49.80Phosphositeplus
Link
147N6-acetyllysineYSYAKRMID
HHHHHHHHH
33.98HPRD
Link
147N6-acetyllysineYSYAKRMID
HHHHHHHHH
33.98Phosphositeplus
Link
147N6-acetyllysine.YSYAKRMID
HHHHHHHHH
33.98UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-147, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures