Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Peptidyl-prolyl cis-trans isomerase FKBP2  

UniProtKB / Swiss-Prot ID :  FKBP2_HUMAN

Gene Name (Synonyms) : 
FKBP2, FKBP13  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Endoplasmic reticulum membrane; Peripheral membrane protein (Probable). 

Protein Function :  PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. 

Protein Sequence MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL...
Predicted Secondary Structure CCHHHHHHHHHEEEEEEHEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEEEEECCEECCCCC...
Protein Variant
LocationDescription
7R -> Q (in dbSNP:rs4672). VAR_050623
21TA -> S. VAR_006410
25A -> T. VAR_006411
97C -> Y. VAR_006412
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
112PhosphotyrosineSELGYGERG
CCCCCCCCC
28.56HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BAT3_HUMANphysical interactionMINT-63616MINT16169070
Q59F94_HUMANphysical interactionMINT-2854823MINT16713569
UBQL4_HUMANphysical interactionMINT-2859005MINT16713569
BAT3_HUMANphysical interactionEBI-734517
intact16169070
UBQL4_HUMANphysical interaction
physical interaction
EBI-954862
EBI-946297
intact16713569
16713569
41_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:01742HPRD9531554
UBQL4_HUMANyeast 2-hybridHPRD:01742HPRD16713569
C1QC_HUMANin vitro
yeast 2-hybrid
HPRD:01742HPRD15353007
BAT3_HUMANyeast 2-hybridHPRD:01742HPRD16169070
E41L2_HUMANENSP00000310935STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures