Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Peptidyl-prolyl cis-trans isomerase FKBP3  

UniProtKB / Swiss-Prot ID :  FKBP3_MOUSE

Gene Name (Synonyms) : 
Fkbp3, Fkbp25  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus (By similarity). 

Protein Function :  FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins (By similarity). 

Protein Sequence MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLVNAYNHLFESK...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCCCCEEEHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
34PhosphoserineQDHGSDSFL
HHHHHHHHH
27.02Phosphositeplus
Link-
36PhosphoserineHGSDSFLAE
HHHHHHHHH
24.69Phosphositeplus
Link-
75PhosphothreonineRFKGTETIS
HHHHHHHHH
30.46Phosphositeplus
Link-
79PhosphoserineTETISKVSE
HHHHHHCCC
34.13Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures