Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Feline leukemia virus subgroup C receptor-related protein 1  

UniProtKB / Swiss-Prot ID :  FLVC1_MUSDU

Gene Name (Synonyms) : 
Flvcr1  

Species :  Mus dunni (Pygmy mouse) (Mus terricolor). 

Subcellular Localization :  Cell membrane; Multi-pass membrane protein (By similarity). 

Protein Function :  Heme transporter that exports cytoplasmic heme; heme export depends on the presence of hemopexin (By similarity). May be required to protect developing erythroid cells from heme toxicity. It can also export coproporphyrin and protoporphyrin IX, which are both intermediate products in the heme biosynthetic pathway (By similarity). Does not export bilirubin (By similarity). Overexpression in tail fibroblasts causes susceptibility to subgroup C feline leukemia viruses (FeLV-C). 

Transmembrane Topology (topPTM) : FLVC1_MUSDU 

Protein Sequence MARPDDEVGPAVAPGHPLGKGYLPVPKGAPDGEARLVPQNGPEALNGGPVLDPLVAGAQDGPQALIAAEE...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCEEEEECCCCHHHCCCCCHHHHHHHHCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures