Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fimbrial protein  

UniProtKB / Swiss-Prot ID :  FMM1_NEIGO

Gene Name (Synonyms) : 
pilE1  

Species :  Neisseria gonorrhoeae. 

Subcellular Localization :  Fimbrium. 

Protein Function :  This protein is the predominant Neisseria surface antigen, which allows adhesion of the bacterium to various host cells. 

Protein Sequence MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWPENNTS...
Predicted Secondary Structure CCCCHHHCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8N-methylphenylalanine.LQKGFTLIE
CHHHCCHHH
6.91UniProtKB
Link
70O-linked (DADDGlc...).ENNTSAGVA
CCCCCCCCC
25.75UniProtKB
Link
70O-linked (GlcNAc)ENNTSAGVA
CCCCCCCCC
25.75OGlycBase
Link
75O-(2-aminoethylphosphoryl)serine;alternate.AGVASPPSD
CCCCCCCCE
34.63UniProtKB
Link
75O-(2-cholinephosphoryl)serine; alternate.AGVASPPSD
CCCCCCCCE
34.63UniProtKB
Link
75Phosphoserine; alternate.AGVASPPSD
CCCCCCCCE
34.63UniProtKB
Link
101O-(sn-1-glycerophosphoryl)serine;partial.ATMLSSGVN
EEECCCCCC
17.77UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Methylation
ReferencePubMed
"Neisseria pili proteins: amino-terminal amino acid sequences andidentification of an unusual amino acid.";
Hermodson M.A., Chen K.C., Buchanan T.M.;
Biochemistry 17:442-445(1978).
Cited for: PROTEIN SEQUENCE OF 8-36, AND METHYLATION AT PHE-8.
"Gonococcal pili. Primary structure and receptor binding domain.";
Schoolnik G.K., Fernandez R., Tai J.Y., Rothbard J., Gotschlich E.C.;
J. Exp. Med. 159:1351-1370(1984).
Cited for: PROTEIN SEQUENCE OF 8-165, AND PRESENCE OF PHOSPHORYLATION.
"Structure of the fibre-forming protein pilin at 2.6-A resolution.";
Parge H.E., Forest K.T., Hickey M.J., Christensen D.A., Getzoff E.,Tainer J.A.;
Nature 378:32-38(1995).
Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 8-165, METHYLATION AT PHE-8,GLYCOSYLATION AT SER-70, AND SEQUENCE REVISION TO C-TERMINUS.
Phosphorylation
ReferencePubMed
"Crystallographic structure reveals phosphorylated pilin fromNeisseria: phosphoserine sites modify type IV pilus surface chemistryand fibre morphology.";
Forest K.T., Dunham S.A., Koomey M., Tainer J.A.;
Mol. Microbiol. 31:743-752(1999).
Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 8-165, PHOSPHORYLATION ATSER-75, GLYCOSYLATION AT SER-70, ALPHA-GLYCEROPHOSPHORYLATION ATSER-101, MUTAGENESIS OF SER-75, AND MASS SPECTROMETRY.
"Unique modifications with phosphocholine and phosphoethanolaminedefine alternate antigenic forms of Neisseria gonorrhoeae type IVpili.";
Hegge F.T., Hitchen P.G., Aas F.E., Kristiansen H., Lovold C.,Egge-Jacobsen W., Panico M., Leong W.Y., Bull V., Virji M.,Morris H.R., Dell A., Koomey M.;
Proc. Natl. Acad. Sci. U.S.A. 101:10798-10803(2004).
Cited for: ETHANOLAMINEPHOSPHORYLATION AT SER-75, AND CHOLINEPHOSPHORYLATION ATSER-75.
"Neisseria gonorrhoeae type IV pili undergo multisite, hierarchicalmodifications with phosphoethanolamine and phosphocholine requiring anenzyme structurally related to lipopolysaccharide phosphoethanolaminetransferases.";
Aas F.E., Egge-Jacobsen W., Winther-Larsen H.C., Lovold C.,Hitchen P.G., Dell A., Koomey M.;
J. Biol. Chem. 281:27712-27723(2006).
Cited for: ETHANOLAMINEPHOSPHORYLATION AT SER-75, AND CHOLINEPHOSPHORYLATION ATSER-75.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures