Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Dimethylaniline monooxygenase [N-oxide-forming] 2  

UniProtKB / Swiss-Prot ID :  FMO2_MACMU

Gene Name (Synonyms) : 
FMO2  

Species :  Macaca mulatta (Rhesus macaque). 

Subcellular Localization :  Microsome membrane. Endoplasmic reticulum membrane (By similarity). 

Protein Function :  This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. 

Protein Sequence MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKEKVEDGRASIYQSVVTNTSKEMSCFS...
Predicted Secondary Structure CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCEEEEEEHHHCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
492Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) (interchain with G-Cter in SUMO-IFTQKQRIL
EEECHHHHC
38.19UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures