Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Folate receptor alpha  

UniProtKB / Swiss-Prot ID :  FOLR1_HUMAN

Gene Name (Synonyms) : 
FOLR1, FOLR  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. Secreted (Probable). 

Protein Function :  Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. 

Protein Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNT...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
28W -> R (in dbSNP:rs7928649). VAR_059284
160W -> C (in dbSNP:rs1801932). VAR_011963
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
161N-linked (Glc...)HKGWNWTSG
CCCCCCCCC
40.59HPRD
Link
161N-linked (GlcNAc...).HKGWNWTSG
CCCCCCCCC
40.59UniProtKB
Link
201N-linked (Glc...)YKVSNYSRG
HCCCCCCCC
41.61HPRD
Link
201N-linked (GlcNAc...).YKVSNYSRG
HCCCCCCCC
41.61UniProtKB
Link
234GPI-anchor amidated serineAAAMSGAGP
HHHHCCCCC
22.29HPRD
Link-
234GPI-anchor amidated serine.AAAMSGAGP
HHHHCCCCC
22.29UniProtKB
Link-
235GPI-anchor amidated glycineAAMSGAGPW
HHHCCCCCH
22.82HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
H01295 Neurodegeneration due to cerebral folate transport deficiency
OMIM disease
613068Neurodegeneration due to cerebral folate transport deficiency (NCFTD)
Drug Reference
Kegg drug
D09343 Farletuzumab (genetical recombination) (JAN); Farletuzumab (USAN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Preferred sites of glycosylphosphatidylinositol modification infolate receptors and constraints in the primary structure of thehydrophobic portion of the signal.";
Yan W., Ratnam M.;
Biochemistry 34:14594-14600(1995).
Cited for: GPI-ANCHOR AT SER-234.
"Proteomic analysis of glycosylphosphatidylinositol-anchored membraneproteins.";
Elortza F., Nuehse T.S., Foster L.J., Stensballe A., Peck S.C.,Jensen O.N.;
Mol. Cell. Proteomics 2:1261-1270(2003).
Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY.
"Modification-specific proteomics of plasma membrane proteins:identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.";
Elortza F., Mohammed S., Bunkenborg J., Foster L.J., Nuehse T.S.,Brodbeck U., Peck S.C., Jensen O.N.;
J. Proteome Res. 5:935-943(2006).
Cited for: GPI-ANCHOR [LARGE SCALE ANALYSIS], AND MASS SPECTROMETRY.
"Computational approach for identification and characterization ofGPI-anchored peptides in proteomics experiments.";
Omaetxebarria M.J., Elortza F., Rodriguez-Suarez E., Aloria K.,Arizmendi J.M., Jensen O.N., Matthiesen R.;
Proteomics 7:1951-1960(2007).
Cited for: GPI-ANCHOR AT SER-234, AND MASS SPECTROMETRY.
N-linked Glycosylation
ReferencePubMed
"Identification of N-linked glycoproteins in human milk by hydrophilicinteraction liquid chromatography and mass spectrometry.";
Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.;
Proteomics 8:3833-3847(2008).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-161 AND ASN-201, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures