Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  FGFR1 oncogene partner  

UniProtKB / Swiss-Prot ID :  FR1OP_MOUSE

Gene Name (Synonyms) : 
Fgfr1op  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, cytoskeleton, centrosome. Note=Associated with gamma-tubulin (By similarity). 

Protein Function :  Required for anchoring microtubules to the centrosomes (By similarity). 

Protein Sequence MAATTAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNENLKKFLNTKD...
Predicted Secondary Structure CCHHHHHHHHHCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCH...
Protein Variant
LocationDescription
20L -> R (in strain: C57BL/6J).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
152PhosphoserineALDLSDGHP
HHHHHHCCC
41.01Phosphositeplus
Link-
160PhosphoserinePPSKSPEGK
CCCCCCCCC
32.30Phosphositeplus
Link-
207PhosphoserineEPSVSLSES
CCCCCCCCC
30.43Phosphositeplus
Link-
209PhosphoserineSVSLSESKS
CCCCCCCCC
32.11Phosphositeplus
Link-
211PhosphoserineSLSESKSKS
CCCCCCCHH
38.56Phosphositeplus
Link-
213PhosphoserineSESKSKSSL
CCCCCHHHH
47.23Phosphositeplus
Link-
326PhosphoserineEKIGSLGLG
HHHCCCCCC
23.80Phosphositeplus
Link-
337PhosphotyrosineEDEDYADDF
CCHHHHHHC
15.19Phosphositeplus
Link-
337Phosphotyrosine.EDEDYADDF
CCHHHHHHC
15.19UniProtKB
Link-
348PhosphoserineASHRSEKSE
HHHCCHHHH
43.91Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling.";
Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.;
J. Immunol. 179:5864-5876(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-337, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures