Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Fragile X mental retardation syndrome-related protein 1  

UniProtKB / Swiss-Prot ID :  FXR1_MOUSE

Gene Name (Synonyms) : 
Fxr1, Fxr1h  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  RNA-binding protein required for embryonic and postnatal development of muscle tissue. May regulate intracellular transport and local translation of certain mRNAs. 

Protein Sequence MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSR...
Predicted Secondary Structure CCCEEEEEECCCCCCHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHCCCCCEEEEEEC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
68PhosphotyrosineEVEVYSRAN
EEEEEECCC
4.48Phosphositeplus
Link-
68PhosphotyrosineEVEVYSRAN
EEEEEECCC
4.48SysPTM
Link-
68Phosphotyrosine.EVEVYSRAN
EEEEEECCC
4.48UniProtKB
Link-
125PhosphothreonineVKKNTFFKC
CCCCCEEEE
39.05Phosphositeplus
Link-
398PhosphothreonineKGYATDEST
CCCCCCCHH
31.64Phosphositeplus
Link-
401PhosphoserineATDESTVSS
CCCCHHCCC
36.60Phosphositeplus
Link-
402PhosphothreonineTDESTVSSV
CCCHHCCCC
23.51Phosphositeplus
Link-
404PhosphoserineESTVSSVQG
CHHCCCCCC
25.53Phosphositeplus
Link-
405PhosphoserineSTVSSVQGS
HHCCCCCCC
17.70Phosphositeplus
Link-
435PhosphoserineNSELSNPSE
CCCCCCCHH
42.52PhosphoELM
Link-
435PhosphoserineNSELSNPSE
CCCCCCCHH
42.52Phosphositeplus
Link-
435PhosphoserineNSELSNPSE
CCCCCCCHH
42.52SysPTM
Link-
435Phosphoserine.NSELSNPSE
CCCCCCCHH
42.52UniProtKB
Link-
438PhosphoserineLSNPSETES
CCCCHHHHH
62.49Phosphositeplus
Link-
438PhosphoserineLSNPSETES
CCCCHHHHH
62.49SysPTM
Link-
440PhosphothreonineNPSETESER
CCHHHHHHH
49.50Phosphositeplus
Link-
449PhosphoserineKDELSDWSL
HHCCCCCCC
34.68Phosphositeplus
Link-
449PhosphoserineKDELSDWSL
HHCCCCCCC
34.68SysPTM
Link-
452PhosphoserineLSDWSLAGE
CCCCCCCCC
17.21Phosphositeplus
Link-
452PhosphoserineLSDWSLAGE
CCCCCCCCC
17.21SysPTM
Link-
506PhosphotyrosineDSNPYSLLD
CCCCCCCCC
19.05PhosphoELM
Link-
506PhosphotyrosineDSNPYSLLD
CCCCCCCCC
19.05Phosphositeplus
Link-
506PhosphotyrosineDSNPYSLLD
CCCCCCCCC
19.05SysPTM
Link-
512PhosphothreonineLLDNTESDQ
CCCCCCCCC
36.21Phosphositeplus
Link-
514PhosphoserineDNTESDQTA
CCCCCCCCC
32.74Phosphositeplus
Link-
517PhosphothreonineESDQTADTD
CCCCCCCCC
31.34Phosphositeplus
Link-
523PhosphoserineDTDASESHH
CCCCCCCCC
42.30Phosphositeplus
Link-
525PhosphoserineDASESHHST
CCCCCCCCC
24.81Phosphositeplus
Link-
529PhosphothreonineSHHSTNRRR
CCCCCCCCC
28.52Phosphositeplus
Link-
555PhosphothreonineTESDTASVN
HCCCCCCCC
30.06Phosphositeplus
Link-
613PhosphothreonineLPRETLAKN
CCHHHHHCC
33.04Phosphositeplus
Link-
613PhosphothreonineLPRETLAKN
CCHHHHHCC
33.04SysPTM
Link-
641Phosphoserine.NGPTSASGD
CCCCCCCHH
24.46UniProtKB
Link-
643PhosphoserinePTSASGDEI
CCCCCHHHC
46.69Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling.";
Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.;
J. Immunol. 179:5864-5876(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-68, AND MASSSPECTROMETRY.
"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-435, AND MASSSPECTROMETRY.
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-641, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures