Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glucose-6-phosphate isomerase  

UniProtKB / Swiss-Prot ID :  G6PI_BOVIN

Gene Name (Synonyms) : 
GPI  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cytoplasm. Secreted (By similarity). 

Protein Function :  Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons (By similarity). 

Protein Sequence MAALTQNPQFKKLKTWYEQHGSDLNLRRLFEGDRDRFNRFSLNLNTNHGHILVDYSKNLVTETVMQMLVD...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHEEEEEECCCCEEEEEHHHCCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures