Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  4-aminobutyrate aminotransferase, mitochondrial  

UniProtKB / Swiss-Prot ID :  GABT_PIG

Gene Name (Synonyms) : 
ABAT, GABAT  

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Mitochondrion matrix. 

Protein Function :  Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine. 

Protein Sequence MASVLLTRRLACSFRHNHRLLVPGWRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMKQLNIIQNAEA...
Predicted Secondary Structure CCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHEECCCCCCCCCCCCEECCCCCCHHHHHHHHHCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
357N6-(pyridoxal phosphate)lysine.MTFSKKMMT
EEECCCCCC
40.26UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures