Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  UDP-glucose 4-epimerase  

UniProtKB / Swiss-Prot ID :  GALE_HUMAN

Gene Name (Synonyms) : 
GALE  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N- acetylgalactosamine. 

Protein Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ...
Predicted Secondary Structure CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCH...
Protein Variant
LocationDescription
25A -> V (in EDG). VAR_037733
34N -> S (in EDG; peripheral; nearly normalactivity towards UDP-galactose).
40R -> C (in EDG). VAR_037734
69D -> E (in EDG). VAR_037735
90G -> E (in EDG; 800-fold decrease in UDP-galactose epimerization activity;
94V -> M (in EDG; generalized; 30-folddecrease in UDP-galactose epimerization
103D -> G (in EDG; 7-fold decrease in UDP-galactose epimerization activity; very
165E -> K (in EDG). VAR_037736
169R -> W (in EDG). VAR_037737
180A -> V (in dbSNP:rs3204468). VAR_002542
183L -> P (in EDG; peripheral; 3-folddecrease in UDP-galactose epimerization
239R -> W (in EDG). VAR_037738
257K -> R (in EDG; 7-fold decrease in UDP-galactose epimerization activity; does
302G -> D (in EDG). VAR_037739
313L -> M (in EDG; 6-fold decrease in UDP-galactose epimerization activity; very
319G -> E (in EDG; nearly normal activitytowards UDP-galactose; mild impairment
335R -> H (in EDG; 2-fold decrease in UDP-galactose epimerization activity).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
100Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ESVQKPLDY
CCCCCHHHH
45.45Phosphositeplus
Link
120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEIMKAHGV
HHHHHHCCC
42.78Phosphositeplus
Link
157PhosphotyrosineCTNPYGKSK
CCCHHHHHH
38.98Phosphositeplus
Link
161Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YGKSKFFIE
HHHHHHHHH
48.02Phosphositeplus
Link
249Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDLAKGHIA
HHHHHHHHH
59.32Phosphositeplus
Link
267PhosphotyrosineGCRIYNLGT
CEEEEEECC
5.74HPRD
Link
271PhosphothreonineYNLGTGTGY
EEECCCCCC
34.43HPRD
Link
273PhosphothreonineLGTGTGYSV
ECCCCCCCH
32.55HPRD
Link
286Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QAMEKASGK
HHHHHHCCC
34.46Phosphositeplus
Link
338Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WRWQKQNPS
HHHHHHCCC
45.12Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GALE_HUMANphysical interactionEBI-757870
intact16189514
GALE_HUMANin vitro
yeast 2-hybrid
HPRD:06092HPRD10801319
11279032
11279193
16189514
GALK1_HUMANENSP00000313026STRING
TGDS_HUMANENSP00000313026STRING
RDH12_HUMANENSP00000313026STRING
GALM_HUMANENSP00000313026STRING
DHB12_HUMANENSP00000313026STRING
RDH13_HUMANENSP00000313026STRING
3BHS7_HUMANENSP00000313026STRING
LALBA_HUMANENSP00000313026STRING
LALBA_HUMANENSP00000313026STRING
UGDH_HUMANENSP00000313026STRING
UGPA_HUMANENSP00000313026STRING
B4GT2_HUMANENSP00000313026STRING
AK1BA_HUMANENSP00000313026STRING
- top -

Disease Reference
Kegg disease
OMIM disease
230350Epimerase-deficiency galactosemia (EDG)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures