Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Galactokinase  

UniProtKB / Swiss-Prot ID :  GALK1_HUMAN

Gene Name (Synonyms) : 
GALK1, GALK  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Major enzyme for galactose metabolism. 

Protein Sequence MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKD...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCEEEEEECEEEECCCEEEEEEECCCEEEEEEECCC...
Protein Variant
LocationDescription
28P -> T (in GALCT2; founder Romanimutation).
32V -> M (in GALCT2). VAR_002547
36G -> R (in GALCT2). VAR_023486
44H -> Y (in GALCT2). VAR_023487
68R -> C (in GALCT2). VAR_023488
184I -> M. VAR_023489
198A -> V (in GALCT2; mild deficiency;Osaka).
239R -> Q (in GALCT2). VAR_023490
274G -> D. VAR_023491
288T -> M (in GALCT2). VAR_023492
338V -> A. VAR_023493
346G -> S (in GALCT2). VAR_023494
349G -> S (in GALCT2). VAR_023495
384A -> P (in GALCT2). VAR_023496
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
69Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSPRKDGLV
EEECCCCEE
60.58Phosphositeplus
Link
217Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSDPKLAVL
CCCCCEEEE
54.81Phosphositeplus
Link
236PhosphotyrosineASSEYPVRR
CCCHHHHHH
14.69Phosphositeplus
Link
272Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLVSKEGFR
HHHHHHHHH
55.14Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AGAL_HUMANENSP00000225614STRING
LPH_HUMANENSP00000225614STRING
GALM_HUMANENSP00000225614STRING
ALDR_HUMANENSP00000225614STRING
ALDR_HUMANENSP00000225614STRING
KITH_HUMANENSP00000225614STRING
BGAL_HUMANENSP00000225614STRING
GALE_HUMANENSP00000225614STRING
- top -

Disease Reference
Kegg disease
OMIM disease
230200Galactosemia II (GALCT2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures