Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2  

UniProtKB / Swiss-Prot ID :  GBG2_BOVIN

Gene Name (Synonyms) : 
GNG2  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). 

Protein Function :  Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. 

Protein Sequence MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASNNT
---CCCCCC
22.44UniProtKB
Link-
68Cysteine methyl ester.KKFFCAIL
CCCCCCCC
2.31UniProtKB
Link-
68S-geranylgeranyl cysteine.KKFFCAIL
CCCCCCCC
2.31UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Determination of the complete covalent structure of the gamma 2subunit of bovine brain G proteins by mass spectrometry.";
Wilcox M.D., Schey K.L., Busman M., Hildebrandt J.D.;
Biochem. Biophys. Res. Commun. 212:367-374(1995).
Cited for: PROTEIN SEQUENCE OF 2-71, ACETYLATION AT ALA-2, AND ISOPRENYLATION ATCYS-68.
Prenylation
ReferencePubMed
"Determination of the complete covalent structure of the gamma 2subunit of bovine brain G proteins by mass spectrometry.";
Wilcox M.D., Schey K.L., Busman M., Hildebrandt J.D.;
Biochem. Biophys. Res. Commun. 212:367-374(1995).
Cited for: PROTEIN SEQUENCE OF 2-71, ACETYLATION AT ALA-2, AND ISOPRENYLATION ATCYS-68.
"Gamma-subunits of G proteins, but not their alpha- or beta-subunits,are polyisoprenylated. Studies on post-translational modificationsusing in vitro translation with rabbit reticulocyte lysates.";
Sanford J., Codina J., Birnbaumer L.;
J. Biol. Chem. 266:9570-9579(1991).
Cited for: ISOPRENYLATION AT CYS-68.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures