Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2  

UniProtKB / Swiss-Prot ID :  GBG2_MOUSE

Gene Name (Synonyms) : 
Gng2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). 

Protein Function :  Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. 

Protein Sequence MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MASNNTA
--CCCCCCC
29.34Phosphositeplus
Link-
6PhosphothreonineASNNTASIA
CCCCCCCHH
26.49Phosphositeplus
Link-
8PhosphoserineNNTASIAQA
CCCCCHHHH
19.20Phosphositeplus
Link-
52PhosphothreonineDPLLTPVPA
CCCCCCCCC
29.89PhosphoELM
Link-
52PhosphothreonineDPLLTPVPA
CCCCCCCCC
29.89Phosphositeplus
Link-
52PhosphothreonineDPLLTPVPA
CCCCCCCCC
29.89SysPTM
Link-
52Phosphothreonine.DPLLTPVPA
CCCCCCCCC
29.89UniProtKB
Link-
57PhosphoserinePVPASENPF
CCCCCCCCC
31.66Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations.";
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.;
Mol. Cell. Proteomics 6:283-293(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-52, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures