Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  GTP cyclohydrolase 1  

UniProtKB / Swiss-Prot ID :  GCH1_RAT

Gene Name (Synonyms) : 
Gch1, Gch  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). 

Protein Function :  May positively regulate nitric oxide synthesis in endothelial cells. May be involved in dopamine synthesis (By similarity). May modify pain sensitivity and persistence. 

Protein Sequence MEKPRGVRCTNGFPERELPRPGASRPAEKSRPPEAKGAQPADAWKAGRPRSEEDNELNLPNLAAAYSSIL...
Predicted Secondary Structure CCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
51PhosphoserineGRPRSEEDN
CCCCCHHCC
48.28Phosphositeplus
Link
72PhosphoserineSILRSLGED
HHHHHHCCC
36.96Phosphositeplus
Link
85PhosphothreonineGLLKTPWRA
CHHHHHHHH
28.22Phosphositeplus
Link
91PhosphothreonineWRAATAMQF
HHHHHHHHH
22.98Phosphositeplus
Link
103PhosphothreonineGYQETISDV
HHCCCHHHH
15.40Phosphositeplus
Link
130PhosphoserineIDMFSMCEH
CCEEEECCC
18.84Phosphositeplus
Link
167PhosphoserineVEIYSRRLQ
HHHHHCCCH
19.31Phosphositeplus
Link
231PhosphothreonineEDPKTREEF
CCHHHHHHH
49.02Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures