Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Gamma-tubulin complex component 3  

UniProtKB / Swiss-Prot ID :  GCP3_HUMAN

Gene Name (Synonyms) : 
TUBGCP3, GCP3  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytoskeleton, centrosome. 

Protein Function :  Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome. 

Protein Sequence MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREAD...
Predicted Secondary Structure CCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
208T -> S (in dbSNP:rs1044287). VAR_049251
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
133PhosphotyrosineTPYYYARPQ
CCEEEECCC
7.12Phosphositeplus
Link-
220Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ATTSKGVPS
CCCCCCCCC
62.93Phosphositeplus
Link-
264Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GIDGKNIKM
CCCCEEEEC
52.32Phosphositeplus
Link-
280Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KVEGKANLS
EEECCCCCC
22.16Phosphositeplus
Link-
303Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WLHNKIRRY
HHHHHHHHH
27.17Phosphositeplus
Link-
375Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TYDPKIRLK
HHHHHHHHH
37.24Phosphositeplus
Link-
405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HAYTKTGDP
HHHHHCCCH
37.52Phosphositeplus
Link-
455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DPTVKTDRL
CCCCCCHHH
47.38Phosphositeplus
Link-
463Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LWHDKYTLR
HCCCCCEEC
27.52Phosphositeplus
Link-
480PhosphoserineTMDQSRKVL
CHHHHHHHH
29.79HPRD
Link-
512PhosphoserineAVTKSAESP
HHHHHHHCC
28.09HPRD
Link-
512Phosphoserine.AVTKSAESP
HHHHHHHCC
28.09UniProtKB
Link-
515PhosphoserineKSAESPQDA
HHHHCCCCH
27.81Phosphositeplus
Link-
543Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FETSKYLLD
HHHHHHHHH
47.54Phosphositeplus
Link-
551Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DVLNKKYSL
HHHHHHHHH
49.26Phosphositeplus
Link-
831Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEENKRIGE
HHCCHHHHH
48.98Phosphositeplus
Link-
837Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IGEFKESIP
HHHHHHHHH
46.37Phosphositeplus
Link-
839PhosphoserineEFKESIPKM
HHHHHHHHH
44.79HPRD
Link-
896PhosphoserineRLRVSLGTR
CCCCCCCCC
18.04HPRD
Link-
896PhosphoserineRLRVSLGTR
CCCCCCCCC
18.04Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TBG1_HUMANin vivoHPRD:10289HPRD9566969
AKAP9_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:10289HPRD12221128
TBG2_HUMANin vivoHPRD:10289HPRD9566969
PCNT_HUMANin vivoHPRD:10289HPRD12221128
TBG2_HUMANENSP00000261965STRING
TBG1_HUMANENSP00000261965STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-512, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures