Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Rho GDP-dissociation inhibitor 1  

UniProtKB / Swiss-Prot ID :  GDIR1_RAT

Gene Name (Synonyms) : 
Arhgdia  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them (By similarity). 

Protein Sequence MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
34PhosphoserinePAQKSIQEI
19.88Phosphositeplus
Link-
50N6,N6-dimethyllysineESLRKYKEA
67.00Phosphositeplus
Link-
52N6,N6-dimethyllysineLRKYKEALL
39.28Phosphositeplus
Link-
101PhosphoserineFKKQSFVLK
26.63Phosphositeplus
Link-
111N2,N2-dimethylarginineGVEYRIKIS
15.37Phosphositeplus
Link-
144PhosphotyrosineDKTDYMVGS
10.03Phosphositeplus
Link-
148PhosphoserineYMVGSYGPR
18.59Phosphositeplus
Link-
152N2,N2-dimethylarginineSYGPRAEEY
50.71Phosphositeplus
Link-
180N2,N2-dimethylarginineNIKSRFTDD
33.22Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures