Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Geranylgeranyl pyrophosphate synthase  

UniProtKB / Swiss-Prot ID :  GGPPS_HUMAN

Gene Name (Synonyms) : 
GGPS1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. 

Protein Sequence MEKTQETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNS...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
17Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEPYKYLLQ
HHHHHHHCC
39.89Phosphositeplus
Link
25N6-acetyllysineQLPGKQVRT
CCCCHHHHH
43.62HPRD
Link
25N6-acetyllysineQLPGKQVRT
CCCCHHHHH
43.62Phosphositeplus
Link
25N6-acetyllysine.QLPGKQVRT
CCCCHHHHH
43.62UniProtKB
Link
60PhosphoserineLHNASLLID
HHHHHHHHC
29.09Phosphositeplus
Link
70PhosphoserineIEDNSKLRR
CCCCCCCCC
45.44Phosphositeplus
Link
87PhosphoserineYGIPSVINS
CCCCHHHHH
33.44Phosphositeplus
Link
91PhosphoserineSVINSANYV
HHHHHHHHH
13.53Phosphositeplus
Link
94PhosphotyrosineNSANYVYFL
HHHHHHHHH
9.02Phosphositeplus
Link
113Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PDAVKLFTR
HHHHHHHHH
39.33Phosphositeplus
Link
196Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NLHSKEYSE
CCCCCHHHH
50.34Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
FDFT_HUMANENSP00000282841STRING
IDI2_HUMANENSP00000282841STRING
ERG19_HUMANENSP00000282841STRING
ERG19_HUMANENSP00000282841STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00399Zoledronate
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-25, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures