Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Globin  

UniProtKB / Swiss-Prot ID :  GLB_BUCUU

Gene Name (Synonyms) :  -
 

Species :  Buccinum undatum (Common whelk). 

Subcellular Localization :   

Protein Function :   

Protein Sequence ALTEPQKTALKDSWKLLAGDGKTMMKSGALLFGLLFKSHPDTKKHFKHFDDATFATMDTGVGKAHGMAVF...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----ALTEP
----CCCHH
34.20UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino-acid sequence of a cooperative, dimeric myoglobin from thegastropod mollusc, Buccinum undatum L.";
Wen D., Laursen R.A.;
Biochim. Biophys. Acta 1208:263-267(1994).
Cited for: PROTEIN SEQUENCE, SUBUNIT, AND ACETYLATION AT ALA-1.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures