Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutamine synthetase  

UniProtKB / Swiss-Prot ID :  GLNA_MOUSE

Gene Name (Synonyms) : 
Glul, Glns  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Mitochondrion (By similarity). 

Protein Function :  Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). 

Protein Sequence MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQS...
Predicted Secondary Structure CCCCCCCHHHHHHHHHHHHCCCCCCEEEEEEEECCEECCCEEEEEEECCCCCCHHHCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATSAS
---CCCCCC
15.40UniProtKB
Link-
19PhosphoserineQMYMSLPQG
HHHHHCCCC
21.29Phosphositeplus
Link-
104PhosphotyrosineEVFKYNRKP
EEECCCCCC
14.56Phosphositeplus
Link-
104PhosphotyrosineEVFKYNRKP
EEECCCCCC
14.56SysPTM
Link-
104Phosphotyrosine.EVFKYNRKP
EEECCCCCC
14.56UniProtKB
Link-
180PhosphotyrosineVEAHYRACL
HHHHHHHHH
13.62Phosphositeplus
Link-
180PhosphotyrosineVEAHYRACL
HHHHHHHHH
13.62SysPTM
Link-
180Phosphotyrosine.VEAHYRACL
HHHHHHHHH
13.62UniProtKB
Link-
183S-nitrosocysteineHYRACLYAG
HHHHHHHCC
1.90dbSNO
Link-
185PhosphotyrosineRACLYAGVK
HHHHHCCCC
10.95SysPTM
Link-
209S-nitrosocysteineQIGPCEGIR
ECCCCHHHH
6.70dbSNO
Link-
328PhosphothreonineRIPRTVGQE
ECCCCCCCC
24.51Phosphositeplus
Link-
343PhosphoserineDRRPSANCD
EECCCCCCC
30.24Phosphositeplus
Link-
343PhosphoserineDRRPSANCD
EECCCCCCC
30.24SysPTM
Link-
359S-nitrosocysteineIVRTCLLNE
HHHHHCCCC
2.59dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-104 AND TYR-180, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures