Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glyoxalase domain-containing protein 4  

UniProtKB / Swiss-Prot ID :  GLOD4_HUMAN

Gene Name (Synonyms) : 
GLOD4, C17orf25 CGI-150, My027  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion (Probable). 

Protein Function :   

Protein Sequence MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSDYTRITEDSFSKPYDGKWSK...
Predicted Secondary Structure CCCCEEEEEEEEEECHHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEE...
Protein Variant
LocationDescription
282M -> I (in dbSNP:rs17851349). VAR_031128
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAARRA
---CCCCEE
15.07UniProtKB
Link
221S-nitrosocysteineIAFSCPQKE
EEEECCCCC
3.15dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NUDT9_HUMANin vitro
yeast 2-hybrid
HPRD:12678HPRD12897971
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures