Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glyoxalase domain-containing protein 4  

UniProtKB / Swiss-Prot ID :  GLOD4_MOUSE

Gene Name (Synonyms) : 
Glod4  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Mitochondrion (By similarity). 

Protein Function :   

Protein Sequence MATRRALHFVFKVKNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAE...
Predicted Secondary Structure CCCCEEEEEEEEEECHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
41S-nitrosocysteineFEEGCKAAC
CCCCCCCCC
2.83dbSNO
Link-
108PhosphoserineEWPLSKVAE
CCCCCCCCE
22.47Phosphositeplus
Link-
131PhosphoserineLQDRSPSQS
EEECCCCCC
36.87Phosphositeplus
Link-
133PhosphoserineDRSPSQSDP
ECCCCCCCC
43.49Phosphositeplus
Link-
151PhosphoserineDLQKSLNYW
CHHHHHHHH
14.64Phosphositeplus
Link-
182S-nitrosocysteineADNQCKLEL
CCCCEEEEE
7.33dbSNO
Link-
222PhosphoserineMKRESHSIL
HHHHCCCEE
26.94Phosphositeplus
Link-
224PhosphoserineRESHSILTP
HHCCCEECC
28.68Phosphositeplus
Link-
227PhosphothreonineHSILTPLVS
CCEECCCCC
16.95Phosphositeplus
Link-
231PhosphoserineTPLVSLDTP
CCCCCCCCC
28.36Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures