Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutaredoxin-1  

UniProtKB / Swiss-Prot ID :  GLRX1_HUMAN

Gene Name (Synonyms) : 
GLRX, GRX  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. 

Protein Sequence MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV...
Predicted Secondary Structure CHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCCCC...
Protein Variant
LocationDescription
47D -> Y (in dbSNP:rs4767). VAR_049189
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAQEFV
---CHHHHH
20.01UniProtKB
Link
8S-nitrosocysteineEFVNCKIQP
HHHHHHHHC
3.27dbSNO
Link
20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VVFIKPTCP
EEEECCCCH
23.86Phosphositeplus
Link
79S-nitrosocysteineIGKDCIGGC
ECCEEECCH
3.38dbSNO
Link
83S-nitrosocysteineCIGGCSDLV
EECCHHHHH
2.11dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PTN1_HUMANin vitro
in vivo
HPRD:02707HPRD10350489
NFIC_HUMANin vitro
in vivo
HPRD:02707HPRD9417094
7961993
RIR1_HUMANENSP00000237858STRING
RIR2_HUMANENSP00000237858STRING
M3K5_HUMANENSP00000237858STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures