Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutaredoxin-3  

UniProtKB / Swiss-Prot ID :  GLRX3_HUMAN

Gene Name (Synonyms) : 
GLRX3, PICOT, TXNL2 HUSSY-22  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cell cortex. Cytoplasm, myofibril, sarcomere, Z line (By similarity). Note=Under the plasma membrane. After PMA stimulation, GLRX3 and PRKCQ/PKC-theta translocate to a more extended submembrane area. In the Z line, found associated with CSRP3  

Protein Function :  Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator (By similarity). May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity. 

Protein Sequence MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
21Q -> H (in dbSNP:rs13991). VAR_016875
123P -> S (in dbSNP:rs2274217). VAR_016876
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
92Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FLFFKNSQK
48.64Phosphositeplus
Link
92N6-acetyllysineFLFFKNSQK
48.64HPRD
Link
101Caspase cleavage aspartic acidIDRLDGAHA
53.80Phosphositeplus
Link
109PhosphothreonineAPELTKKVQ
27.45Phosphositeplus
Link
118PhosphoserineRHASSGSFL
38.96HPRD
Link-
120PhosphoserineASSGSFLPS
26.09HPRD
Link-
240Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EERLKVLTN
41.23Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
F10C1_HUMANphysical interactionMINT-64736MINT16169070
HEXDC_HUMANphysical interactionMINT-65043MINT16169070
Q8TE81_HUMANphysical interactionMINT-65043MINT16169070
KR412_HUMANphysical interactionMINT-67117MINT16189514
KPCD2_HUMANphysical interactionMINT-61762MINT15231748
ATL4_HUMANphysical interactionMINT-67598MINT16189514
ATL4_HUMANphysical interactionEBI-757588
intact16189514
NADK_HUMANphysical interactionEBI-754057
intact16189514
KR412_HUMANphysical interactionEBI-756010
intact16189514
FBLN4_HUMANphysical interactionEBI-756547
intact16189514
CPIN1_HUMANphysical interactionEBI-758329
intact16189514
KPCT_HUMANcolocalization
physical interaction
physical interaction
physical interaction
physical interaction
EBI-374816
EBI-374803
EBI-516
intact10636891
10636891
10636891
10636891
10636891
KPCT_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:10153HPRD10636891
GLRX3_HUMANin vitro
yeast 2-hybrid
HPRD:10153HPRD10636891
CPIN1_HUMANyeast 2-hybridHPRD:10153HPRD16189514
KR412_HUMANyeast 2-hybridHPRD:10153HPRD16189514
NADK_HUMANyeast 2-hybridHPRD:10153HPRD16189514
ATL4_HUMANyeast 2-hybridHPRD:10153HPRD16189514
F10C1_HUMANyeast 2-hybridHPRD:10153HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures