Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutaredoxin-3  

UniProtKB / Swiss-Prot ID :  GLRX3_MOUSE

Gene Name (Synonyms) : 
Glrx3, Picot, Txnl2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, cell cortex (By similarity). Cytoplasm, myofibril, sarcomere, Z line (By similarity). Note=Under the plasma membrane. After PMA stimulation, GLRX3 and PRKCQ/PKC-theta translocate to a more extended submembrane area (By similarity). In the Z li 

Protein Function :  Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity. Has an essential function in embryogenesis. 

Protein Sequence MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKL...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
148S-nitrosocysteineHAAPCMLFM
2.95dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures