Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine hydroxymethyltransferase, cytosolic  

UniProtKB / Swiss-Prot ID :  GLYC_HUMAN

Gene Name (Synonyms) : 
SHMT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Interconversion of serine and glycine. 

Protein Sequence MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN...
Predicted Secondary Structure CCCCHHHHCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHH...
Protein Variant
LocationDescription
340E -> Q (in dbSNP:rs7215148). VAR_059795
474L -> F (in dbSNP:rs1979277). VAR_022010
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylthreonine---MTMPVN
---CCCCHH
30.13HPRD
Link-
27Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQPLKDSDV
HHHHHHHCH
62.97Phosphositeplus
Link
29PhosphoserinePLKDSDVEV
HHHHHCHHH
41.80HPRD
Link
29PhosphoserinePLKDSDVEV
HHHHHCHHH
41.80Phosphositeplus
Link
34PhosphotyrosineDVEVYNIIK
CHHHHHHHH
6.27HPRD
Link
34PhosphotyrosineDVEVYNIIK
CHHHHHHHH
6.27Phosphositeplus
Link
34Phosphotyrosine.DVEVYNIIK
CHHHHHHHH
6.27UniProtKB
Link
38Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)YNIIKKESN
HHHHHHHHH
46.84Phosphositeplus
Link
38Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YNIIKKESN
HHHHHHHHH
46.84Phosphositeplus
Link
39Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)NIIKKESNR
HHHHHHHHH
56.84Phosphositeplus
Link
72Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CLNNKYSEG
HHHCCCCCC
49.43Phosphositeplus
Link
73PhosphotyrosineLNNKYSEGY
HHCCCCCCC
17.68Phosphositeplus
Link
118PhosphotyrosineNVQPYSGSP
CCCCCCCHH
14.47Phosphositeplus
Link
173Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SMPYKVNPD
EECCCCCCC
29.66Phosphositeplus
Link
257N6-(pyridoxal phosphate)lysine.TTTHKTLRG
CCCCCCCCC
47.35UniProtKB
Link
271N6-acetyllysineIFYRKGVKS
EEECCCCCC
57.59HPRD
Link
271N6-acetyllysine.IFYRKGVKS
EEECCCCCC
57.59UniProtKB
Link
416Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLLEKDFQK
CCCHHHHHH
64.91Phosphositeplus
Link
420Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KDFQKVAHF
HHHHHHHHH
41.19Phosphositeplus
Link
456Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAGDKYQAA
CCCCCCHHH
38.04Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
LEU1_HUMANphysical interactionEBI-731701
intact16169070
PIM1_HUMANphysical interactionEBI-733310
intact16169070
CSK2B_HUMANin vitroHPRD:01643HPRD10549165
PRS23_HUMANyeast 2-hybridHPRD:01643HPRD16169070
C1TC_HUMANENSP00000318868STRING
FMT_HUMANENSP00000318868STRING
SYSM_HUMANENSP00000318868STRING
OXDA_HUMANENSP00000318868STRING
AGT2_HUMANENSP00000318868STRING
SYSC_HUMANENSP00000318868STRING
SYSC_HUMANENSP00000318868STRING
PUR9_HUMANENSP00000318868STRING
KBL_HUMANENSP00000318868STRING
SDHL_HUMANENSP00000318868STRING
AL9A1_HUMANENSP00000318868STRING
FTHFD_HUMANENSP00000318868STRING
GCST_HUMANENSP00000318868STRING
SERB_HUMANENSP00000318868STRING
SPYA_HUMANENSP00000318868STRING
TYSY_HUMANENSP00000318868STRING
SOX_HUMANENSP00000318868STRING
TMLH_HUMANENSP00000318868STRING
CBS_HUMANENSP00000318868STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00145Glycine
DB01055Mimosine
DB00116Tetrahydrofolic acid
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-271, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-34, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures