Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine hydroxymethyltransferase, cytosolic  

UniProtKB / Swiss-Prot ID :  GLYC_MOUSE

Gene Name (Synonyms) : 
Shmt1, Shmt  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Interconversion of serine and glycine. 

Protein Sequence MADRDATLWASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEG...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHCCHHHHCHHHHHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
23PhosphoserinePLKDSDAEV
CHHHHCHHH
36.81SysPTM
Link
28PhosphotyrosineDAEVYSIIK
CHHHHHHHH
5.90PhosphoELM
Link
28PhosphotyrosineDAEVYSIIK
CHHHHHHHH
5.90Phosphositeplus
Link
28PhosphotyrosineDAEVYSIIK
CHHHHHHHH
5.90SysPTM
Link
28Phosphotyrosine.DAEVYSIIK
CHHHHHHHH
5.90UniProtKB
Link
29PhosphoserineAEVYSIIKK
HHHHHHHHH
24.02PhosphoELM
Link
29PhosphoserineAEVYSIIKK
HHHHHHHHH
24.02Phosphositeplus
Link
29PhosphoserineAEVYSIIKK
HHHHHHHHH
24.02SysPTM
Link
29Phosphoserine.AEVYSIIKK
HHHHHHHHH
24.02UniProtKB
Link
155PhosphoserineKKKISATSI
CCCCCEEEE
34.08Phosphositeplus
Link
251N6-(pyridoxal phosphate)lysine.TTTHKTLRG
CCCCCCCCC
47.35UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry.";
Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.;
J. Proteome Res. 6:250-262(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-28 AND SER-29, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures