Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glycogenin-1  

UniProtKB / Swiss-Prot ID :  GLYG_HUMAN

Gene Name (Synonyms) : 
GYG1, GYG  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase. 

Protein Sequence MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSA...
Predicted Secondary Structure CCCEEEEEEEECHHHHCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHEEEEEEECCCCCE...
Protein Variant
LocationDescription
83T -> M (in GSD15; inactivation of theautoglucosylation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylthreonine---MTDQAF
---CCCEEE
36.50HPRD
Link
195O-linked (Glc...)SISIYSYLP
CCCCEEECC
5.62HPRD
Link-
209Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GASAKVVHF
CCCEEEEEE
42.15Phosphositeplus
Link
332PhosphotyrosineGQADYMGAD
CCCCCCCCC
10.64HPRD
Link-
332PhosphotyrosineGQADYMGAD
CCCCCCCCC
10.64Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q9BTT9_HUMANphysical interactionEBI-752677
intact16189514
Q96HA1_HUMANphysical interactionEBI-754300
intact16189514
GLYG2_HUMANin vitro
in vivo
HPRD:06805HPRD9857012
PO121_HUMANyeast 2-hybridHPRD:06805HPRD16189514
PYGM_HUMANENSP00000340736STRING
GLGB_HUMANENSP00000340736STRING
GDE_HUMANENSP00000340736STRING
GYS1_HUMANENSP00000340736STRING
- top -

Disease Reference
Kegg disease
OMIM disease
613507Glycogen storage disease 15 (GSD15)
616199Polyglucosan body myopathy 2 (PGBM2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures