Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  GDP-mannose 4,6 dehydratase  

UniProtKB / Swiss-Prot ID :  GMDS_HUMAN

Gene Name (Synonyms) : 
GMDS  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Conversion of GDP-D-mannose to GDP-4-keto-6-D- deoxymannose. 

Protein Sequence MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAHAPA
---CCCCCC
13.93UniProtKB
Link-
10PhosphoserineARCPSARGS
CCCCCCCCC
33.94HPRD
Link-
14PhosphoserineSARGSGDGE
CCCCCCCCC
28.32HPRD
Link-
69PhosphotyrosineIEHLYKNPQ
HHHHHHHHH
15.61Phosphositeplus
Link-
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EHLYKNPQA
HHHHHHHHH
69.39Phosphositeplus
Link-
84PhosphotyrosineMKLHYGDLT
EEEEECCCC
23.83Phosphositeplus
Link
101Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)INEVKPTEI
HHHCCCCEE
39.79Phosphositeplus
Link
301Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VWEGKNENE
CCCCCCHHH
49.96Phosphositeplus
Link
323PhosphotyrosineVDLKYYRPT
CCCCCCCCC
16.41Phosphositeplus
Link
324PhosphotyrosineDLKYYRPTE
CCCCCCCCC
14.45Phosphositeplus
Link
327PhosphothreonineYYRPTEVDF
CCCCCCCCE
39.37Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GMDS_HUMANphysical interactionEBI-755062
intact16189514
GMDS_HUMANyeast 2-hybridHPRD:11925HPRD16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures