Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glycine N-methyltransferase  

UniProtKB / Swiss-Prot ID :  GNMT_RAT

Gene Name (Synonyms) : 
Gnmt  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the methylation of glycine by using S- adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). Possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine. 

Protein Sequence MVDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGV...
Predicted Secondary Structure CCCCHHHHHHCCHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylvaline.---MVDSVY
---CCCCHH
8.26UniProtKB
Link
10PhosphoserineYRTRSLGVA
HHHHHCCHH
28.94Phosphositeplus
Link
72PhosphoserineTGVDSIMLV
CHHHHHHHH
13.90Phosphositeplus
Link
140PhosphoserineCLGNSFAHL
EEHHHHHHC
23.24Phosphositeplus
Link
183PhosphoserineDYILSTGCA
HHHHCCCCC
17.13Phosphositeplus
Link
242PhosphoserineKFRLSYYPH
HEEHEECCH
20.54Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Rat glycine methyltransferase. Complete amino acid sequence deducedfrom a cDNA clone and characterization of the genomic DNA.";
Ogawa H., Konishi K., Takata Y., Nakashima H., Fujioka M.;
Eur. J. Biochem. 168:141-151(1987).
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], AND PROTEIN SEQUENCE OF 2-7.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures