Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glucosamine-6-phosphate isomerase 1  

UniProtKB / Swiss-Prot ID :  GNPI1_HUMAN

Gene Name (Synonyms) : 
GNPDA1, GNPI, HLN, KIAA0060  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo (By similarity). 

Protein Sequence MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFN...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
50N6-acetyllysineLGCYKKLIE
45.22HPRD
Link
64N6-acetyllysineDLSFKYVKT
45.84HPRD
Link
64N6-acetyllysineDLSFKYVKT
45.84Phosphositeplus
Link
64N6-acetyllysine.DLSFKYVKT
45.84UniProtKB
Link
157PhosphothreonineLVSRTRVKT
32.10HPRD
Link
161PhosphothreonineTRVKTLAMD
19.52HPRD
Link
187PhosphothreonineTMALTVGVG
12.99HPRD
Link
256Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VKYFKGLML
48.31Phosphositeplus
Link
264Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVHNKLVDP
34.70Phosphositeplus
Link
273Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LYSIKEKET
57.71Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-64, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures