Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Growth factor receptor-bound protein 2  

UniProtKB / Swiss-Prot ID :  GRB2_HUMAN

Gene Name (Synonyms) : 
GRB2, ASH  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. Cytoplasm. Endosome. Golgi apparatus (By similarity). 

Protein Function :  Adapter protein that provides a critical link between cell surface growth factor receptors and the Ras signaling pathway. Isoform 2 does not bind to phosphorylated epidermal growth factor receptor (EGFR) but inhibits EGF-induced transactivation of a RAS-responsive element. Isoform 2 acts as a dominant negative protein over GRB2 and by suppressing proliferative signals, may trigger active programmed cell death. 

Protein Sequence MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKA...
Predicted Secondary Structure CEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEEECCCEEEEECCCCCCCCCCCCCCCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylmethionine.----MEAIA
----CEEEE
7.67UniProtKB
Link
6N6-acetyllysineEAIAKYDFK
EEEEECCCC
38.96HPRD
Link
6N6-acetyllysineEAIAKYDFK
EEEEECCCC
38.96Phosphositeplus
Link
6N6-acetyllysine.EAIAKYDFK
EEEEECCCC
38.96UniProtKB
Link
7PhosphotyrosineAIAKYDFKA
EEEECCCCC
20.00Phosphositeplus
Link
20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELSFKRGDI
CCCCCCCCE
52.69Phosphositeplus
Link
32S-nitrosocysteineLNEECDQNW
EECCCCCCE
5.49dbSNO
Link
37PhosphotyrosineDQNWYKAEL
CCCEEEEEE
14.10Phosphositeplus
Link
38N6-acetyllysineQNWYKAELN
CCEEEEEEC
27.31HPRD
Link
38N6-acetyllysineQNWYKAELN
CCEEEEEEC
27.31Phosphositeplus
Link
44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ELNGKDGFI
EECCCEEEE
54.31Phosphositeplus
Link
50N6-acetyllysineGFIPKNYIE
EEEECCCCC
58.53HPRD
Link
50N6-acetyllysineGFIPKNYIE
EEEECCCCC
58.53Phosphositeplus
Link
50N6-acetyllysine.GFIPKNYIE
EEEECCCCC
58.53UniProtKB
Link
52PhosphotyrosineIPKNYIEMK
EECCCCCCC
12.37Phosphositeplus
Link
56Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YIEMKPHPW
CCCCCCCCC
27.64Phosphositeplus
Link-
69Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IPRAKAEEM
CCHHHHHHH
58.57Phosphositeplus
Link-
76Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EMLSKQRHD
HHHCCCCCC
47.60Phosphositeplus
Link-
109Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VQHFKVLRD
EEEEEEEEC
37.93Phosphositeplus
Link-
109N6-acetyllysineVQHFKVLRD
EEEEEEEEC
37.93HPRD
Link-
109N6-acetyllysineVQHFKVLRD
EEEEEEEEC
37.93Phosphositeplus
Link-
109N6-acetyllysine.VQHFKVLRD
EEEEEEEEC
37.93UniProtKB
Link-
160PhosphotyrosineQQPTYVQAL
CCCEEEEEE
9.39Phosphositeplus
Link-
160PhosphotyrosineQQPTYVQAL
CCCEEEEEE
9.39SysPTM
Link-
160Phosphotyrosine (SRC)QQPTYVQAL
CCCEEEEEE
9.39HPRD
Link-
160Phosphotyrosine.QQPTYVQAL
CCCEEEEEE
9.39UniProtKB
Link-
209PhosphotyrosineFPRNYVTPV
EEHHHEEEC
13.64HPRD
Link-
209PhosphotyrosineFPRNYVTPV
EEHHHEEEC
13.64Phosphositeplus
Link-
209PhosphotyrosineFPRNYVTPV
EEHHHEEEC
13.64SysPTM
Link-
209Phosphotyrosine (EGFR)FPRNYVTPV
EEHHHEEEC
13.64PhosphoELM
Link-
209Phosphotyrosine.FPRNYVTPV
EEHHHEEEC
13.64UniProtKB
Link-
211PhosphothreonineRNYVTPVNR
HHHEEECCC
15.91HPRD
Link-
211PhosphothreonineRNYVTPVNR
HHHEEECCC
15.91PhosphoELM
Link-
211PhosphothreonineRNYVTPVNR
HHHEEECCC
15.91Phosphositeplus
Link-
211PhosphothreonineRNYVTPVNR
HHHEEECCC
15.91SysPTM
Link-
211Phosphothreonine.RNYVTPVNR
HHHEEECCC
15.91UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
LAT_HUMANdirect interactionMINT-3382320MINT16906159
LAT_HUMANdirect interactionMINT-3382412MINT16906159
EGFR_HUMANphysical interactionMINT-1793777MINT7518560
EGFR_HUMANphysical interactionMINT-58640MINT7527043
EGFR_HUMANphysical interactionMINT-58641MINT7527043
EGFR_HUMANphysical interactionMINT-58642MINT7527043
EGFR_HUMANphysical interactionMINT-74541MINT16273093
EGFR_HUMANphysical interactionMINT-61540MINT12577067
EGFR_HUMANphysical interactionMINT-61494MINT16729043
EGFR_HUMANphysical interactionMINT-61496MINT16729043
EGFR_HUMANphysical interactionMINT-61497MINT16729043
EGFR_HUMANphysical interactionMINT-61500MINT16729043
EGFR_HUMANphysical interactionMINT-61502MINT16729043
K2C8_HUMANphysical interactionMINT-61555MINT12577067
RET_HUMANphysical interactionMINT-60975MINT15677445
MAP2_HUMANphysical interactionMINT-50656MINT15536091
MAP2_HUMANphysical interactionMINT-50658MINT15536091
ERBB3_HUMANphysical interactionMINT-61518MINT16729043
CBL_HUMANphysical interactionMINT-65973MINT7642581
CBL_HUMANphysical interactionMINT-60977MINT15677445
CBL_HUMANphysical interactionMINT-60974MINT15677445
P85A_HUMANphysical interactionMINT-65974MINT7642581
P85A_HUMANphysical interactionMINT-68497MINT16219545
SHC1_HUMANphysical interactionMINT-49658MINT12485888
SHC1_HUMANphysical interactionMINT-61537MINT12577067
TNFL6_HUMANphysical interactionMINT-18323MINT12023017
BAT2_HUMANphysical interactionMINT-62734MINT14667819
BAT2_HUMANphysical interactionMINT-62810MINT14667819
AP2S1_HUMANphysical interactionMINT-61547MINT12577067
GRB2_HUMANphysical interactionMINT-59509MINT12577067
GRB2_HUMANphysical interactionMINT-61538MINT12577067
AP2B1_HUMANphysical interactionMINT-61546MINT12577067
ACTH_HUMANphysical interactionMINT-61553MINT12577067
K1C17_HUMANphysical interactionMINT-61556MINT12577067
KHDR1_HUMANphysical interactionMINT-16932MINT10467411
SOS1_HUMANphysical interactionMINT-1782504MINT7629138
ACK1_HUMANphysical interactionMINT-62876MINT16137687
LCP2_HUMANdirect interactionMINT-4302482MINT17235283
LCP2_HUMANdirect interactionMINT-4302502MINT17235283
CBLB_HUMANphysical interactionMINT-61549MINT12577067
ADA15_HUMANdirect interactionMINT-2792561MINT16374509
ADA15_HUMANphysical interactionMINT-16310MINT11741929
RPGF1_HUMANphysical interactionMINT-14745MINT8621483
RPGF1_HUMANphysical interactionMINT-14744MINT8621483
ERBB4_HUMANphysical interactionMINT-61530MINT16729043
ERBB4_HUMANphysical interactionMINT-61531MINT16729043
ERBB4_HUMANphysical interactionMINT-61532MINT16729043
ERBB4_HUMANphysical interactionMINT-61534MINT16729043
Q5T185_HUMANphysical interactionMINT-60982MINT15688026
Q5T185_HUMANphysical interactionMINT-60983MINT15688026
K1C18_HUMANphysical interactionMINT-61557MINT12577067
BLNK_HUMANphysical interactionMINT-59467MINT10556826
Q96C32_HUMANphysical interactionMINT-61550MINT12577067
AP2M1_HUMANphysical interactionMINT-61548MINT12577067
RGAP1_HUMANphysical interactionMINT-61542MINT12577067
SMU1_HUMANphysical interactionMINT-61564MINT12577067
Q9Y6X7_HUMANphysical interactionMINT-61563MINT12577067
IRS1_HUMANphysical interaction
physical interaction
DIP:1287EDIP8491186
7486683
PGFRB_HUMANphysical interactionDIP:1291EDIP7486683
GRB2_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
MED28_HUMANdirect interaction
physical interaction
direct interaction
EBI-1206616
EBI-1206599
EBI-1
intact15467741
15467741
16899217
LAT_HUMANphysical interactionEBI-1245309
intact16938345
KHDR1_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
EBI-518296
EBI-518222
EBI-780
intact9045636
9045636
11278465
11278465
PTN6_HUMANphysical interactionEBI-965879
intact10660620
EFTU_HUMANphysical interactionEBI-350217
intact12577067
MYH9_HUMANphysical interactionEBI-350217
intact12577067
GSTM3_HUMANphysical interactionEBI-350217
intact12577067
TBA1B_HUMANphysical interactionEBI-350217
intact12577067
LRRF2_HUMANphysical interactionEBI-350217
intact12577067
LMO7_HUMANphysical interactionEBI-350217
intact12577067
GSTM1_HUMANphysical interactionEBI-350217
intact12577067
MYO1C_HUMANphysical interactionEBI-350217
intact12577067
FLNA_HUMANphysical interactionEBI-350217
intact12577067
MLRM_HUMANphysical interactionEBI-350217
intact12577067
ADSV_HUMANphysical interactionEBI-350217
intact12577067
TIAF1_HUMANphysical interactionEBI-350217
intact12577067
ABLM1_HUMANphysical interactionEBI-350217
intact12577067
LUZP1_HUMANphysical interactionEBI-350217
intact12577067
SPEC1_HUMANphysical interactionEBI-350217
intact12577067
SERA_HUMANphysical interactionEBI-350217
intact12577067
ADT1_HUMANphysical interactionEBI-350217
intact12577067
UACA_HUMANphysical interactionEBI-350217
intact12577067
PDLI7_HUMANphysical interactionEBI-350217
intact12577067
RL18A_HUMANphysical interactionEBI-350217
intact12577067
NONO_HUMANphysical interactionEBI-350217
intact12577067
RS5_HUMANphysical interactionEBI-350217
intact12577067
RL27A_HUMANphysical interactionEBI-350217
intact12577067
SAPS3_HUMANphysical interactionEBI-350217
intact12577067
MYO6_HUMANphysical interactionEBI-350217
intact12577067
NPM_HUMANphysical interactionEBI-350217
intact12577067
RL21_HUMANphysical interactionEBI-350217
intact12577067
CT160_HUMANphysical interactionEBI-350217
intact12577067
TPM1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-350217
intact12577067
12577067
MYO3B_HUMANphysical interactionEBI-350217
intact12577067
SERPH_HUMANphysical interactionEBI-350217
intact12577067
ROA2_HUMANphysical interactionEBI-350217
intact12577067
PPIA_HUMANphysical interactionEBI-350217
intact12577067
RL7_HUMANphysical interactionEBI-350217
intact12577067
SRP09_HUMANphysical interactionEBI-350217
intact12577067
TBB3_HUMANphysical interactionEBI-350217
intact12577067
TBB5_HUMANphysical interactionEBI-350217
intact12577067
ODO2_HUMANphysical interactionEBI-350217
intact12577067
KCC2D_HUMANphysical interactionEBI-350217
intact12577067
ITPR3_HUMANphysical interactionEBI-350217
intact12577067
GRWD1_HUMANphysical interactionEBI-350217
intact12577067
HS71L_HUMANphysical interactionEBI-350217
intact12577067
DDX6_HUMANphysical interactionEBI-350217
intact12577067
ABLM3_HUMANphysical interactionEBI-350217
intact12577067
NEB2_HUMANphysical interactionEBI-350217
intact12577067
ACTG_HUMANphysical interactionEBI-350217
intact12577067
CBR1_HUMANphysical interactionEBI-350217
intact12577067
TBB2C_HUMANphysical interactionEBI-350217
intact12577067
COR1C_HUMANphysical interactionEBI-350217
intact12577067
DREB_HUMANphysical interactionEBI-350217
intact12577067
ARP3_HUMANphysical interactionEBI-350217
intact12577067
ATPA_HUMANphysical interactionEBI-350217
intact12577067
SPTA2_HUMANphysical interactionEBI-350217
intact12577067
ARC1A_HUMANphysical interactionEBI-350217
intact12577067
DNJA2_HUMANphysical interactionEBI-350217
intact12577067
ARPC5_HUMANphysical interactionEBI-350217
intact12577067
HNRPF_HUMANphysical interactionEBI-350217
intact12577067
GMFB_HUMANphysical interactionEBI-350217
intact12577067
UGDH_HUMANphysical interactionEBI-350217
intact12577067
RS23_HUMANphysical interactionEBI-350217
intact12577067
RS20_HUMANphysical interactionEBI-350217
intact12577067
RL30_HUMANphysical interactionEBI-350217
intact12577067
RL24_HUMANphysical interactionEBI-350217
intact12577067
DYL1_HUMANphysical interactionEBI-350217
intact12577067
COF1_HUMANphysical interactionEBI-350217
intact12577067
MPCP_HUMANphysical interactionEBI-350217
intact12577067
PRDX1_HUMANphysical interactionEBI-350217
intact12577067
KU70_HUMANphysical interactionEBI-350217
intact12577067
DUT_HUMANphysical interactionEBI-350217
intact12577067
RL23A_HUMANphysical interactionEBI-350217
intact12577067
MYO1A_HUMANphysical interactionEBI-350217
intact12577067
RL23_HUMANphysical interactionEBI-350217
intact12577067
PIMT_HUMANphysical interactionEBI-350217
intact12577067
RL31_HUMANphysical interactionEBI-350217
intact12577067
DLDH_HUMANphysical interactionEBI-350217
intact12577067
RL35A_HUMANphysical interactionEBI-350217
intact12577067
IMDH2_HUMANphysical interactionEBI-350217
intact12577067
SRP14_HUMANphysical interactionEBI-350217
intact12577067
KPYM_HUMANphysical interactionEBI-350217
intact12577067
SSB_HUMANphysical interactionEBI-350217
intact12577067
GSTP1_HUMANphysical interactionEBI-350217
intact12577067
SHC1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
SOS1_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
EBI-350217
EBI-297464
EBI-298
intact12577067
12577067
14679214
14679214
IQGA1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
RGAP1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
VAV2_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
VAV3_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
AP2B1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
AP2S1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
AP2M1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
CBLB_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
UBIQ_HUMANphysical interaction
physical interaction
physical interaction
EBI-350217
EBI-297464
EBI-297
intact12577067
12577067
12577067
PTN11_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
ACTH_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
K2C7_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
K2C8_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
K1C17_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
K1C18_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
PLEC1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
EPIPL_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
CD59_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
H31_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
SMD2_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
Q9Y6X7_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
SMU1_HUMANphysical interaction
physical interaction
EBI-350217
EBI-297464
intact12577067
12577067
AP2A1_HUMANphysical interactionEBI-350217
intact12577067
ARP2_HUMANphysical interactionEBI-350217
intact12577067
RL4_HUMANphysical interactionEBI-350217
intact12577067
CAPZB_HUMANphysical interactionEBI-350217
intact12577067
H2A2A_HUMANphysical interactionEBI-350217
intact12577067
RL36_HUMANphysical interactionEBI-350217
intact12577067
FUSIP_HUMANphysical interactionEBI-350217
intact12577067
RUVB1_HUMANphysical interactionEBI-350217
intact12577067
LIMA1_HUMANphysical interactionEBI-350217
intact12577067
MYH14_HUMANphysical interactionEBI-350217
intact12577067
FSCN1_HUMANphysical interactionEBI-350217
intact12577067
ANM5_HUMANphysical interactionEBI-350217
intact12577067
CYTSA_HUMANphysical interactionEBI-350217
intact12577067
MYO1B_HUMANphysical interactionEBI-350217
intact12577067
IPO7_HUMANphysical interactionEBI-350217
intact12577067
ECHB_HUMANphysical interactionEBI-350217
intact12577067
COR1B_HUMANphysical interactionEBI-350217
intact12577067
RS3_HUMANphysical interactionEBI-350217
intact12577067
RS9_HUMANphysical interactionEBI-350217
intact12577067
COF2_HUMANphysical interactionEBI-350217
intact12577067
GELS_HUMANphysical interactionEBI-350217
intact12577067
ACTN4_HUMANphysical interactionEBI-350217
intact12577067
SVIL_HUMANphysical interactionEBI-350217
intact12577067
FLII_HUMANphysical interactionEBI-350217
intact12577067
SPTB2_HUMANphysical interactionEBI-350217
intact12577067
HNRH1_HUMANphysical interactionEBI-350217
intact12577067
MYL6_HUMANphysical interactionEBI-350217
intact12577067
NEXN_HUMANphysical interactionEBI-350217
intact12577067
ACTN1_HUMANphysical interactionEBI-350217
intact12577067
RAI14_HUMANphysical interactionEBI-350217
intact12577067
MYPT1_HUMANphysical interactionEBI-350217
intact12577067
MYH10_HUMANphysical interactionEBI-350217
intact12577067
PAWR_HUMANphysical interactionEBI-350217
intact12577067
TBA4A_HUMANphysical interactionEBI-350217
intact12577067
ARPC3_HUMANphysical interactionEBI-350217
intact12577067
ARPC4_HUMANphysical interactionEBI-350217
intact12577067
GRP78_HUMANphysical interactionEBI-350217
intact12577067
SRC8_HUMANphysical interactionEBI-350217
intact12577067
HSP7C_HUMANphysical interactionEBI-350217
intact12577067
WDR1_HUMANphysical interactionEBI-350217
intact12577067
LMNA_HUMANphysical interactionEBI-350217
intact12577067
DDX5_HUMANphysical interactionEBI-350217
intact12577067
PABP1_HUMANphysical interactionEBI-350217
intact12577067
DHX9_HUMANphysical interactionEBI-350217
intact12577067
TR150_HUMANphysical interactionEBI-350217
intact12577067
PRKDC_HUMANphysical interactionEBI-350217
intact12577067
FLNB_HUMANphysical interactionEBI-350217
intact12577067
EF1A1_HUMANphysical interactionEBI-350217
intact12577067
DAPK3_HUMANphysical interactionEBI-350217
intact12577067
IF4A1_HUMANphysical interactionEBI-350217
intact12577067
RL3_HUMANphysical interactionEBI-350217
intact12577067
UAP56_HUMANphysical interactionEBI-350217
intact12577067
RBBP7_HUMANphysical interactionEBI-350217
intact12577067
ATD3A_HUMANphysical interactionEBI-350217
intact12577067
HTRA1_HUMANphysical interactionEBI-350217
intact12577067
ACTC_HUMANphysical interactionEBI-350217
intact12577067
ARPC2_HUMANphysical interactionEBI-350217
intact12577067
RS3A_HUMANphysical interactionEBI-350217
intact12577067
RL10_HUMANphysical interactionEBI-350217
intact12577067
RL26_HUMANphysical interactionEBI-350217
intact12577067
H2B1H_HUMANphysical interactionEBI-350217
intact12577067
RS16_HUMANphysical interactionEBI-350217
intact12577067
CH60_HUMANphysical interactionEBI-350217
intact12577067
ANXA6_HUMANphysical interactionEBI-350217
intact12577067
RCC2_HUMANphysical interactionEBI-350217
intact12577067
NUCL_HUMANphysical interactionEBI-350217
intact12577067
EF2_HUMANphysical interactionEBI-350217
intact12577067
HS90B_HUMANphysical interactionEBI-350217
intact12577067
ILF3_HUMANphysical interactionEBI-350217
intact12577067
BCLF1_HUMANphysical interactionEBI-350217
intact12577067
SMCA5_HUMANphysical interactionEBI-350217
intact12577067
MATR3_HUMANphysical interactionEBI-350217
intact12577067
TMOD3_HUMANphysical interactionEBI-350217
intact12577067
ANXA2_HUMANphysical interactionEBI-350217
intact12577067
TPM2_HUMANphysical interactionEBI-350217
intact12577067
ROA1_HUMANphysical interactionEBI-350217
intact12577067
HSPB1_HUMANphysical interactionEBI-350217
intact12577067
RL18_HUMANphysical interactionEBI-350217
intact12577067
RL12_HUMANphysical interactionEBI-350217
intact12577067
RL27_HUMANphysical interactionEBI-350217
intact12577067
RS14_HUMANphysical interactionEBI-350217
intact12577067
RLA2_HUMANphysical interactionEBI-350217
intact12577067
HNRH2_HUMANphysical interactionEBI-350217
intact12577067
TAOK2_HUMANphysical interactionEBI-350217
intact12577067
LC7L2_HUMANphysical interactionEBI-350217
intact12577067
SAFB2_HUMANphysical interactionEBI-350217
intact12577067
S10A6_HUMANphysical interactionEBI-350217
intact12577067
PLST_HUMANphysical interactionEBI-350217
intact12577067
PDCD6_HUMANphysical interactionEBI-350217
intact12577067
PP2BA_HUMANphysical interactionEBI-350217
intact12577067
IF4A3_HUMANphysical interactionEBI-350217
intact12577067
SYNPO_HUMANphysical interactionEBI-350217
intact12577067
RUVB2_HUMANphysical interactionEBI-350217
intact12577067
HNRPK_HUMANphysical interactionEBI-350217
intact12577067
PP1B_HUMANphysical interactionEBI-350217
intact12577067
RS28_HUMANphysical interactionEBI-350217
intact12577067
RS8_HUMANphysical interactionEBI-350217
intact12577067
RS15A_HUMANphysical interactionEBI-350217
intact12577067
RS13_HUMANphysical interactionEBI-350217
intact12577067
H4_HUMANphysical interactionEBI-350217
intact12577067
RS25_HUMANphysical interactionEBI-350217
intact12577067
RS18_HUMANphysical interactionEBI-350217
intact12577067
RS11_HUMANphysical interactionEBI-350217
intact12577067
RS26_HUMANphysical interactionEBI-350217
intact12577067
EF1G_HUMANphysical interactionEBI-350217
intact12577067
GLYM_HUMANphysical interactionEBI-350217
intact12577067
AP2A_HUMANphysical interactionEBI-297464
intact12577067
ADA_HUMANin vitroHPRD:00150HPRD9299436
A4_HUMANin vivoHPRD:00150HPRD12485888
CD22_HUMANin vitro
in vivo
HPRD:00150HPRD11551923
CD72_HUMANin vitroHPRD:00150HPRD10820378
IRS2_HUMANin vivoHPRD:00150HPRD7559579
9852124
CBL_HUMANin vitro
in vivo
HPRD:00150HPRD9295052
11964172
9108392
11133830
917890
98621719
8621483
8995445
8063801
14725908
GRB2_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:00150HPRD7716522
SHC3_HUMANin vivoHPRD:00150HPRD12242309
PAK1_HUMANin vitro
in vivo
HPRD:00150HPRD12522133
NPM_HUMANin vitroHPRD:00150HPRD8633037
ESR1_HUMANin vitro
in vivo
HPRD:00150HPRD15173068
ZAP70_HUMANin vivoHPRD:00150HPRD7629168
CD3Z_HUMANin vivoHPRD:00150HPRD7629168
SYPH_HUMANin vitroHPRD:00150HPRD8547634
PK3CG_HUMANin vivoHPRD:00150HPRD10386953
KS6A1_HUMANin vitro
in vivo
HPRD:00150HPRD8630373
PAK4_HUMANin vitroHPRD:00150HPRD12529371
LIME1_HUMANin vivoHPRD:00150HPRD16249387
SH2B2_HUMANin vitroHPRD:00150HPRD9233773
9856458
SH3K1_HUMANin vitroHPRD:00150HPRD11152963
PNRC1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:00150HPRD15122321
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00061Pegademase bovine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-6; LYS-50 AND LYS-109, ANDMASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-160 AND TYR-209, ANDMASS SPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-211, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures