Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutamate receptor, ionotropic kainate 1  

UniProtKB / Swiss-Prot ID :  GRIK1_HUMAN

Gene Name (Synonyms) : 
GRIK1, GLUR5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. 

Protein Function :  Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L- glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. 

Transmembrane Topology (topPTM) : GRIK1_HUMAN 

Protein Sequence MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKFAVTSINRNRT...
Predicted Secondary Structure CCCEEEEEECHHHHHHHHHEEEEHEEEEHCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCC...
Protein Variant
LocationDescription
332A -> V. VAR_012751
636Q -> R (in RNA edited version). VAR_000304
757I -> V (in dbSNP:rs363494). VAR_012041
862R -> Q. VAR_012752
870A -> V (in dbSNP:rs363503). VAR_012042
902L -> S (in dbSNP:rs363504). VAR_012043
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
487PhosphoserineLKELSNILG
HHHHHHHCC
23.94Phosphositeplus
Link
494PhosphotyrosineLGFIYDVKL
CCCCEEEEE
16.66Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GRIK1_HUMANin vitro
in vivo
HPRD:00693HPRD12597860
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D00537 Topiramate (JAN/USAN/INN); Topamax (TN); Trokendi xr (TN)
D02546 Kainic acid hydrate (JP16); Digenin (TN)
D06656 Tezampanel (USAN); Tezampanel hydrate
DrugBank
DB00273Topiramate
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures