Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutathione synthetase  

UniProtKB / Swiss-Prot ID :  GSHB_HUMAN

Gene Name (Synonyms) : 
GSS  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSALLEQAYAVQM...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCCCCCCCEEEECCHHHCCCCCHHHHHHHHHHHHH...
Protein Variant
LocationDescription
26A -> D (in GSS deficiency). VAR_003602
188L -> P (in GSS deficiency; 100-foldreduction of activity).
219D -> A (in GSS deficiency). VAR_003604
219D -> G (in GSS deficiency;dbSNP:rs28938472).
236R -> Q (in dbSNP:rs34239729). VAR_025047
254L -> R (in GSS deficiency). VAR_003606
267R -> W (in GSS deficiency). VAR_003607
270Y -> C (in GSS deficiency; 100-foldreduction of activity).
270Y -> H (in GSS deficiency; 100-foldreduction of activity).
283R -> C (in GSS deficiency; 10-foldreduction of activity).
286L -> Q (in GSS deficiency). VAR_003611
330R -> C (in GSS deficiency). VAR_003612
437K -> E (in dbSNP:rs34852238). VAR_025048
464G -> V (in GSS deficiency). VAR_003613
469D -> E (in GSS deficiency). VAR_003614
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATNWG
---CCCCHH
15.05UniProtKB
Link
108Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FDIHKQVLK
HHHHHHHHH
42.30Phosphositeplus
Link
112Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KQVLKEGIA
HHHHHCCCC
55.85Phosphositeplus
Link
141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPALKQIEI
CHHHEEEEE
51.87Phosphositeplus
Link
147PhosphothreonineIEINTISAS
EEEEEEEEC
23.21HPRD
Link
147PhosphothreonineIEINTISAS
EEEEEEEEC
23.21Phosphositeplus
Link
151PhosphoserineTISASFGGL
EEEECCCCH
20.03HPRD
Link
186Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NNPSKGLAL
CCCHHHHHH
60.23Phosphositeplus
Link
213Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IAQEKERNI
EEECCCCCH
50.31Phosphositeplus
Link
238PhosphothreonineVIRRTFEDI
EEEEEHHHH
22.87HPRD
Link
238PhosphothreonineVIRRTFEDI
EEEEEHHHH
22.87Phosphositeplus
Link
245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DISEKGSLD
HHHHHCCEE
47.19Phosphositeplus
Link
270PhosphotyrosineFRDGYMPRQ
EECCCCCCC
14.29Phosphositeplus
Link
384Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VQALKQLKD
HHHHHHCCC
57.51Phosphositeplus
Link
415PhosphoserineLRPGSPARV
ECCCCCHHH
20.33HPRD
Link
415PhosphoserineLRPGSPARV
ECCCCCHHH
20.33Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GSHB_HUMANin vivoHPRD:03000HPRD7646467
GSHR_HUMANENSP00000216951STRING
GSH1_HUMANENSP00000216951STRING
AMPN_HUMANENSP00000216951STRING
GGT5_HUMANENSP00000216951STRING
GGT4_HUMANENSP00000216951STRING
GPX4_HUMANENSP00000216951STRING
OPLA_HUMANENSP00000216951STRING
GPX6_HUMANENSP00000216951STRING
- top -

Disease Reference
Kegg disease
OMIM disease
266130Glutathione synthetase deficiency (GSS deficiency)
231900Glutathione synthetase deficiency of erythrocytes (GLUSYNDE)
Drug Reference
DrugBank
DB06151Acetylcysteine
DB00143Glutathione
DB00145Glycine
DB00151L-Cysteine
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures