Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutathione reductase, mitochondrial  

UniProtKB / Swiss-Prot ID :  GSHR_HUMAN

Gene Name (Synonyms) : 
GSR, GLUR, GRD1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform Mitochondrial: Mitochondrion. Isoform Cytoplasmic: Cytoplasm. 

Protein Function :  Maintains high levels of reduced glutathione in the cytosol. 

Protein Sequence MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAGAVASYDYLVI...
Predicted Secondary Structure CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCHHHCCCCCCCEEEE...
Protein Variant
LocationDescription
153R -> C (in dbSNP:rs8190955). VAR_019079
232G -> R (in dbSNP:rs8190976). VAR_051775
232G -> S (in dbSNP:rs8190976). VAR_019080
261I -> V (in dbSNP:rs8190997). VAR_019081
297E -> D (in dbSNP:rs8191004). VAR_019082
314P -> H (in dbSNP:rs2020916). VAR_014554
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
65PhosphotyrosineAVASYDYLV
CCCCCCEEE
10.00PhosphoELM
Link-
65PhosphotyrosineAVASYDYLV
CCCCCCEEE
10.00Phosphositeplus
Link-
65Phosphotyrosine.AVASYDYLV
CCCCCCEEE
10.00UniProtKB
Link-
102S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)LGGTCVNVG
CCCEEECCC
2.07HPRD
Link-
107S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)VNVGCVPKK
ECCCCCCCC
4.05HPRD
Link-
181Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSDPKPTIE
ECCCEEEEE
60.84Phosphositeplus
Link-
189Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EVSGKKYTA
EECCCEEEE
34.79Phosphositeplus
Link-
300Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEVKKTLSG
EEEEECCCC
60.93Phosphositeplus
Link-
340Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPNTKDLSL
EECCCCCCC
64.41Phosphositeplus
Link-
346Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSLNKLGIQ
CCCCCCCCE
54.08Phosphositeplus
Link-
401N6-acetyllysineLFEYKEDSK
HHHCCCCCE
48.09HPRD
Link-
401N6-acetyllysineLFEYKEDSK
HHHCCCCCE
48.09Phosphositeplus
Link-
405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEDSKLDYN
CCCCEECCC
58.67Phosphositeplus
Link-
408PhosphotyrosineSKLDYNNIP
CEECCCCCC
22.12Phosphositeplus
Link-
441Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IENVKTYST
CEEEEEEEC
54.01Phosphositeplus
Link
451PhosphotyrosineFTPMYHAVT
CCCCCCCCC
6.45Phosphositeplus
Link
455PhosphothreonineYHAVTKRKT
CCCCCCCCC
26.39HPRD
Link
455PhosphothreonineYHAVTKRKT
CCCCCCCCC
26.39Phosphositeplus
Link
456Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HAVTKRKTK
CCCCCCCCC
45.35Phosphositeplus
Link
501Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MGATKADFD
CCCCHHHHH
45.48Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PJA1_HUMANphysical interactionEBI-734739
intact16169070
GSHR_HUMANin vitroHPRD:00704HPRD9151953
PJA1_HUMANyeast 2-hybridHPRD:00704HPRD16169070
GSHB_HUMANENSP00000221130STRING
GRIA2_HUMANENSP00000221130STRING
GRIA4_HUMANENSP00000221130STRING
GGT5_HUMANENSP00000221130STRING
GGT4_HUMANENSP00000221130STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-65, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures