Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Glutathione S-transferase P 1  

UniProtKB / Swiss-Prot ID :  GSTP1_MOUSE

Gene Name (Synonyms) : 
Gstp1, Gstpib  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). Mitochondrion (By similarity). Nucleus (By similarity). Note=The 83 N-terminal amino-acids function as un uncleaved transit peptide, and arginine residues within it are crucial for motochondrial localization (By similarity). 

Protein Function :  Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Can metabolize 1-chloro-2,4-dinitrobenzene. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration (By similarity). 

Protein Sequence MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAIL...
Predicted Secondary Structure CCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEECHHCCHHHHCCCCCCCCCCCEEEECCEEEEHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8PhosphotyrosineYTIVYFPVR
CEEEEECCC
9.79Phosphositeplus
Link
8PhosphotyrosineYTIVYFPVR
CEEEEECCC
9.79SysPTM
Link
48S-nitrosocysteineLKPTCLYGQ
CCCCCCCCC
3.60dbSNO
Link-
109PhosphotyrosineVTLIYTNYE
HHHHCCCHH
7.64Phosphositeplus
Link
109PhosphotyrosineVTLIYTNYE
HHHHCCCHH
7.64SysPTM
Link
109Phosphotyrosine.VTLIYTNYE
HHHHCCCHH
7.64UniProtKB
Link
110PhosphothreonineTLIYTNYEN
HHHCCCHHH
25.08Phosphositeplus
Link
135PhosphoserineETLLSQNQG
HHHHHHHCC
30.14Phosphositeplus
Link
209N6-acetyllysineNGNGKQ
CCCCCC
57.76Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-109, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures