Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Guanylyl cyclase-activating protein 1  

UniProtKB / Swiss-Prot ID :  GUC1A_CHICK

Gene Name (Synonyms) : 
GUCA1A, GCAP1  

Species :  Gallus gallus (Chicken). 

Subcellular Localization :   

Protein Function :  Stimulates guanylyl cyclase 1 (GC1) when free calcium ions concentration is low and inhibits GC1 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure (By similarity). 

Protein Sequence MGNMDGKAVEELSATECHQWYKKFMTECPSGQLTLYEFKQFFGLKNLSPSANKYVEQMFETFDFNKDGYI...
Predicted Secondary Structure CCCCCHHHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-myristoyl glycine.---MGNMDG
---CCCCCH
37.86UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Myristoylation
ReferencePubMed
"Stabilizing function for myristoyl group revealed by the crystalstructure of a neuronal calcium sensor, guanylate cyclase-activatingprotein 1.";
Stephen R., Bereta G., Golczak M., Palczewski K., Sousa M.C.;
Structure 15:1392-1402(2007).
Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 2-199, CALCIUM-BINDING, ANDMYRISTOYLATION AT GLY-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures