Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Histone H3  

UniProtKB / Swiss-Prot ID :  H3_YEAST

Gene Name (Synonyms) : 
HHT1 YBR010W YBR0201
HHT2, SIN2 YNL031C N2749  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Nucleus. Chromosome. 

Protein Function :  Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP, UAF seems to stimulate basal transcription to a fully activated level. 

Protein Sequence MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQR...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5N6,N6,N6-trimethyllysine; alternate.MARTKQTAR
CCCCCCCCC
39.85UniProtKB
Link-
5N6,N6-dimethyllysine; alternate.MARTKQTAR
CCCCCCCCC
39.85UniProtKB
Link-
5N6-methyllysine; alternate.MARTKQTAR
CCCCCCCCC
39.85UniProtKB
Link-
10N6-acetyllysine; alternate.QTARKSTGG
CCCCCCCCC
50.32UniProtKB
Link-
10N6-methyllysine; alternate.QTARKSTGG
CCCCCCCCC
50.32UniProtKB
Link-
11PhosphoserineTARKSTGGK
CCCCCCCCC
27.08PhosphoELM
Link-
11Phosphoserine.TARKSTGGK
CCCCCCCCC
27.08UniProtKB
Link-
15N6,N6-dimethyllysine; alternate.STGGKAPRK
CCCCCCCCC
57.47UniProtKB
Link-
15N6-acetyllysine; alternate.STGGKAPRK
CCCCCCCCC
57.47UniProtKB
Link-
19N6-acetyllysine; alternate.KAPRKQLAS
CCCCCCCCC
48.91UniProtKB
Link-
19N6-methyllysine; alternate.KAPRKQLAS
CCCCCCCCC
48.91UniProtKB
Link-
24N6-acetyllysine; alternate.QLASKAARK
CCCCCCCCC
40.22UniProtKB
Link-
24N6-methyllysine; alternate.QLASKAARK
CCCCCCCCC
40.22UniProtKB
Link-
28N6,N6,N6-trimethyllysine; alternate.KAARKSAPS
CCCCCCCCC
46.36UniProtKB
Link-
28N6,N6-dimethyllysine; alternate.KAARKSAPS
CCCCCCCCC
46.36UniProtKB
Link-
28N6-acetyllysine; alternate.KAARKSAPS
CCCCCCCCC
46.36UniProtKB
Link-
28N6-methyllysine; alternate.KAARKSAPS
CCCCCCCCC
46.36UniProtKB
Link-
37N6,N6,N6-trimethyllysine; alternate.TGGVKKPHR
CCCCCCCCC
64.95UniProtKB
Link
37N6,N6-dimethyllysine; alternate.TGGVKKPHR
CCCCCCCCC
64.95UniProtKB
Link
37N6-acetyllysine; alternate.TGGVKKPHR
CCCCCCCCC
64.95UniProtKB
Link
37N6-methyllysine; alternate.TGGVKKPHR
CCCCCCCCC
64.95UniProtKB
Link
57N6-acetyllysine.RRFQKSTEL
HHHHCCCCC
57.54UniProtKB
Link
65N6-acetyllysine.LLIRKLPFQ
CHHHCCCHH
54.22UniProtKB
Link
80N6,N6,N6-trimethyllysine; alternate.AQDFKTDLR
HHHCCCCCC
49.79UniProtKB
Link
80N6,N6-dimethyllysine; alternate.AQDFKTDLR
HHHCCCCCC
49.79UniProtKB
Link
80N6-methyllysine; alternate.AQDFKTDLR
HHHCCCCCC
49.79UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Query failed : Got error 28 from storage engine
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed