Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Histone acetyltransferase type B catalytic subunit  

UniProtKB / Swiss-Prot ID :  HAT1_HUMAN

Gene Name (Synonyms) : 
HAT1, KAT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Isoform A: Nucleus matrix. Isoform B: Cytoplasm. Nucleus. Nucleus matrix. Nucleus, nucleoplasm. Note=Localization is predominantly nuclear in normal cells. Treatment with hydrogen peroxide or ionizing radiation enhances nuclear localization through redis 

Protein Function :  Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage. 

Protein Sequence MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYK...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHEECCCCCCCCCCCCCEEEEEE...
Protein Variant
LocationDescription
317A -> P (in a colorectal cancer sample;somatic mutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGFGA
---CCCHHH
23.25UniProtKB
Link-
9Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GAMEKFLVE
HHHHHHHHH
30.80Phosphositeplus
Link-
15Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LVEYKSAVE
HHHHHHHHH
20.59Phosphositeplus
Link-
26Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LAEYKCNTN
CCCCCCCCC
16.71Phosphositeplus
Link
280Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDPSKSYVK
ECHHHHHHH
51.71Phosphositeplus
Link
304Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FSREKLMQG
CCCCCCCCC
48.42Phosphositeplus
Link
320Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAQQKFKIN
HHHHHHCCC
36.22Phosphositeplus
Link
350PhosphoserineEQYRSYRLD
CCCCHHHHH
15.07Phosphositeplus
Link-
351PhosphotyrosineQYRSYRLDI
CCCHHHHHH
13.24Phosphositeplus
Link-
361PhosphoserineRRLISPYKK
HHHCCCHHH
27.11HPRD
Link-
361PhosphoserineRRLISPYKK
HHHCCCHHH
27.11PhosphoELM
Link-
361PhosphoserineRRLISPYKK
HHHCCCHHH
27.11Phosphositeplus
Link-
361PhosphoserineRRLISPYKK
HHHCCCHHH
27.11SysPTM
Link-
361Phosphoserine.RRLISPYKK
HHHCCCHHH
27.11UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
1433Z_HUMANphysical interactionMINT-3296639MINT15161933
SMAD7_HUMANin vitro
in vivo
HPRD:04339HPRD12408818
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-361, AND MASSSPECTROMETRY.
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-361, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures