Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Hemoglobin subunit beta  

UniProtKB / Swiss-Prot ID :  HBB_HUMAN

Gene Name (Synonyms) : 
HBB  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Involved in oxygen transport from the lung to the various peripheral tissues. LVV-hemorphin-7 potentiates the activity of bradykinin, causing a decrease in blood pressure. 

Protein Sequence MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG...
Predicted Secondary Structure CCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCHHHCCCCHHHHHHHHHHHH...
Protein Variant
LocationDescription
2V -> A (in Raleigh; O(2) affinity down;dbSNP:rs33949930).
3H -> L (in Graz; dbSNP:rs35906307). VAR_002857
3H -> Q (in Okayama; O(2) affinity up;dbSNP:rs713040).
3H -> R (in Deer Lodge; O(2) affinity up;dbSNP:rs33983205).
3H -> Y (in Fukuoka; dbSNP:rs35906307). VAR_002860
6P -> R (in Warwickshire;dbSNP:rs34769005).
7E -> A (in G-Makassar). VAR_002862
7E -> K (in C). VAR_002864
7E -> Q (in Machida; dbSNP:rs33930165). VAR_002865
7E -> V (in S; sickle cell anemia;dbSNP:rs334).
8E -> G (in G-San Jose; mildly unstable;dbSNP:rs34948328).
8E -> K (in G-Siriraj; dbSNP:rs34948328). VAR_002867
9K -> E (in N-Timone; dbSNP:rs33932981). VAR_002868
9K -> Q (in J-Luhe; dbSNP:rs33926764). VAR_002869
9K -> T (in Rio Grande). VAR_002870
10S -> C (in Porto Alegre; O(2) affinityup; dbSNP:rs33918131).
11A -> D (in Ankara; dbSNP:rs33947457). VAR_002872
11A -> V (in Iraq-Halabja). VAR_025393
12V -> D (in Windsor; O(2) affinity up;unstable; dbSNP:rs33974228).
12V -> I (in Hamilton). VAR_002874
14A -> D (in J-Lens; dbSNP:rs35203747). VAR_002875
15L -> P (in Saki; unstable). VAR_002876
15L -> R (in Soegn; unstable;dbSNP:rs33935445).
16W -> G (in Randwick; unstable;dbSNP:rs33946157).
16W -> R (in Belfast; O(2) affinity up;unstable; dbSNP:rs33946157).
17G -> D (in J-Baltimore/J-Trinidad/J-Ireland/J-Georgia/N-New Haven).
17G -> R (in D-Bushman). VAR_002881
18K -> E (in Nagasaki; dbSNP:rs33986703). VAR_002882
18K -> N (in J-Amiens; dbSNP:rs36006214). VAR_002883
18K -> Q (in Nikosia; dbSNP:rs33986703). VAR_002884
19V -> M (in Baden; slightly unstable;dbSNP:rs35802118).
20N -> D (in Alamo; dbSNP:rs34866629). VAR_002886
20N -> K (in D-Ouleh RABAH). VAR_002887
20N -> S (in Malay; dbSNP:rs33972047). VAR_002888
21V -> M (in Olympia; O(2) affinity up;dbSNP:rs35890959).
22D -> G (in Connecticut; O(2) affinitydown; dbSNP:rs33977536).
22D -> H (in Karlskoga; dbSNP:rs33950093). VAR_002892
22D -> N (in Cocody). VAR_002891
22D -> Y (in Yusa). VAR_002893
23E -> A (in G-Coushatta/G-Saskatoon/G-Taegu/Hsin Chu; dbSNP:rs33936254).
23E -> G (in G-Taipei). VAR_002895
23E -> K (in E-Saskatoon; unstable). VAR_002896
23E -> Q (in D-Iran). VAR_002897
23E -> V (in D-Granada). VAR_002898
24V -> D (in Strasbourg; O(2) affinity up). VAR_002899
24V -> F (in Palmerston North; O(2)affinity up; unstable).
24V -> G (in Miyashiro; O(2) affinity up;unstable).
25G -> D (in Moscva; O(2) affinity down;unstable).
25G -> R (in Riverdale-Bronx; O(2) affinityup; unstable).
25G -> V (in Savannah; unstable). VAR_002904
26G -> D (in J-Auckland; unstable; O(2)affinity down).
26G -> R (in G-Taiwan Ami). VAR_002906
27E -> K (in E). VAR_002907
27E -> V (in Henri Mondor; slightlyunstable).
28A -> D (in Volga/Drenthe; unstable). VAR_002909
28A -> S (in Knossos). VAR_002910
28A -> V (in Grange-blanche; O(2) affinityup).
29L -> P (in Genova/Hyogo; unstable). VAR_002912
29L -> Q (in St Louis). VAR_035236
30G -> D (in Lufkin; unstable). VAR_002913
31R -> S (in Tacoma; unstable). VAR_002914
32L -> P (in Yokohama; unstable). VAR_002915
33L -> R (in Castilla; unstable). VAR_002916
33L -> V (in Muscat; slightly unstable). VAR_002917
35V -> D (in Santander; unstable). VAR_025394
35V -> F (in Pitie-Salpetriere; O(2)affinity up).
35V -> L (in Nantes; increased oxygenaffinity).
36Y -> F (in Philly; O(2) affinity up;unstable).
37P -> R (in Sunnybrook). VAR_002920
37P -> S (in North Chicago; O(2) affinityup).
37P -> T (in Linkoping/Finlandia; O(2)affinity up).
38W -> G (in Howick). VAR_002923
38W -> R (in Rothschild; O(2) affinitydown).
38W -> S (in Hirose; O(2) affinity up). VAR_002924
39T -> N (in Hinwil; O(2) affinity up). VAR_002926
40Q -> E (in Vaasa; unstable). VAR_002927
40Q -> K (in Alabama). VAR_002928
40Q -> R (in Tianshui). VAR_002929
42F -> Y (in Mequon). VAR_002930
42Missing (in Bruxelles). VAR_035237
43F -> L (in Louisville; unstable). VAR_002931
43F -> S (in Hammersmith). VAR_035239
43Missing (in Bruxelles). VAR_035238
44E -> Q (in Hoshida/Chaya). VAR_002932
45S -> C (in Mississippi). VAR_002933
46F -> S (in Cheverly; unstable). VAR_002934
47G -> E (in K-Ibadan). VAR_002935
48D -> A (in Avicenna). VAR_002936
48D -> G (in Gavello). VAR_002937
48D -> Y (in Maputo). VAR_002938
49L -> P (in Bab-Saadoum; slightlyunstable).
50S -> F (in Las Palmas; slightlyunstable).
51T -> K (in Edmonton). VAR_002941
52P -> R (in Willamette; O(2) affinity up;unstable).
53D -> A (in Ocho Rios). VAR_002943
53D -> H (in Summer Hill). VAR_002944
55V -> D (in Jacksonville; O(2) affinityup; unstable).
56M -> K (in Matera; unstable). VAR_002946
57G -> R (in Hamadan). VAR_002947
58N -> K (in G-ferrara; unstable). VAR_002948
59P -> R (in Dhofar/Yukuhashi). VAR_002949
60K -> E (in I-High Wycombe). VAR_002950
61V -> A (in Collingwood; unstable). VAR_002951
62K -> E (in N-Seatlle). VAR_002952
62K -> M (in Bologna; O(2) affinity down). VAR_002953
62K -> N (in Hikari). VAR_002954
63A -> D (in J-Europa). VAR_002955
63A -> P (in Duarte; unstable). VAR_002956
64H -> Y (in M-Saskatoon; O(2) affinityup).
66K -> M (in J-Antakya). VAR_002958
66K -> N (in J-Sicilia). VAR_002959
66K -> Q (in J-Cairo). VAR_002960
67K -> T (in Chico; O(2) affinity down). VAR_002961
68V -> A (in Sydney; unstable). VAR_002962
68V -> D (in Bristol). VAR_035240
68V -> G (in non-spherocytic haemolyticanemia; Manukau; dbSNP:rs33918343).
68V -> M (in Alesha; unstable). VAR_002963
69L -> H (in Brisbane; O(2) affinity up). VAR_002964
69L -> P (in Mizuho; unstable). VAR_002965
70G -> D (in Rambam). VAR_002966
70G -> R (in Kenitra). VAR_002967
70G -> S (in City of Hope). VAR_002968
71A -> D (in Seattle; O(2) affinity down;unstable).
72F -> S (in Christchurch; unstable). VAR_002970
74D -> G (in Tilburg; O(2) affinity down). VAR_002971
74D -> V (in Mobile; O(2) affinity down). VAR_002972
74D -> Y (in Vancouver; O(2) affinitydown).
75G -> R (in Aalborg; unstable). VAR_002974
75G -> V (in Bushwick; unstable). VAR_002975
76L -> P (in Atlanta; unstable). VAR_002976
76L -> R (in Pasadena; O(2) affinity up;unstable).
77A -> D (in J-Chicago). VAR_002978
78H -> D (in J-Iran). VAR_002979
78H -> R (in Costa Rica). VAR_002980
78H -> Y (in Fukuyama). VAR_002981
79L -> R (in Quin-hai). VAR_002982
80D -> Y (in Tampa). VAR_002983
81N -> K (in G-Szuhu/Gifu). VAR_002984
82L -> H (in La Roche-sur-Yon; unstable andO(2) affinity up).
82L -> R (in Baylor; unstable). VAR_002985
82L -> V (in dbSNP:rs11549406). VAR_049273
83K -> M (in Helsinki; O(2) affinity up). VAR_002986
83K -> N (in Providence). VAR_012664
84G -> D (in Pyrgos). VAR_025396
84G -> R (in Muskegon). VAR_002987
85T -> I (in Kofu). VAR_002988
87A -> D (in Olomouc; O(2) affinity up). VAR_002989
88T -> I (in Quebec-Chori). VAR_002990
88T -> K (in D-Ibadan). VAR_002991
88T -> P (in Valletta). VAR_002992
89L -> P (in Santa Ana; unstable). VAR_002993
89L -> R (in Boras; unstable). VAR_002994
90S -> N (in Creteil; O(2) affinity up). VAR_002995
90S -> R (in Vanderbilt; O(2) affinity up). VAR_002996
91E -> D (in Pierre-Benite; O(2) affinityup).
91E -> K (in Agenogi; O(2) affinity down). VAR_002998
92L -> P (in Sabine; unstable). VAR_002999
92L -> R (in Caribbean; O(2) affinity down;unstable).
93H -> D (in J-Altgelds Gardens; unstable). VAR_003001
93H -> N (in Isehara; unstable). VAR_003002
93H -> P (in Newcastle and Duino;associated with S-104 in Duino;
93H -> Q (in Istambul; O(2) affinity up;unstable).
94C -> R (in Okazaki; O(2) affinity up;unstable).
95D -> G (in Chandigarh). VAR_003006
95D -> H (in Barcelona; O(2) affinity up). VAR_003007
95D -> N (in Bunbury; O(2) affinity up). VAR_003008
96K -> M (in J-Cordoba). VAR_003009
96K -> N (in Detroit). VAR_003010
97L -> P (in Debrousse; unstable; O(2)affinity up).
97L -> V (in Regina; O(2) affinity up). VAR_003012
98H -> L (in Wood; O(2) affinity up). VAR_003013
98H -> P (in Nagoya; O(2) affinity up;unstable).
98H -> Q (in Malmoe; O(2) affinity up). VAR_003015
98H -> Y (in Moriguchi). VAR_003016
99V -> G (in Nottingham; unstable). VAR_003017
100D -> E (in Coimbra; O(2) affinity up). VAR_003018
101P -> L (in Brigham; O(2) affinity up). VAR_003019
101P -> R (in New Mexico). VAR_003020
102E -> D (in Potomac; O(2) affinity up). VAR_003021
102E -> G (in Alberta; O(2) affinity up). VAR_003022
102E -> K (in British Columbia; O(2)affinity up).
102E -> Q (in Rush; unstable). VAR_003024
103N -> S (in Beth Israel; O(2) affinitydown; unstable).
103N -> Y (in St Mande; O(2) affinity down). VAR_003026
104F -> L (in Heathrow; O(2) affinity up). VAR_003027
105R -> S (in Camperdown and Duino;associated with P-92 in Duino; unstable).
105R -> T (in Sherwood Forest). VAR_003029
108G -> R (in Burke; O(2) affinity down;unstable).
109N -> K (in Presbyterian; O(2) affinitydown; unstable).
110V -> M (in San Diego; O(2) affinity up). VAR_003032
111L -> P (in Showa-Yakushiji). VAR_003033
112V -> A (in Stanmore; O(2) affinity down;unstable).
113C -> F (in Canterbury). VAR_025397
113C -> R (in Indianapolis). VAR_003035
113C -> Y (in Yahata). VAR_003036
115L -> M (in Zengcheng). VAR_010144
115L -> P (in Durham-N.C./Brescia; causesbeta-thalassemia).
116A -> D (in Hradec Kralove; unstable;causes severe beta-thalassemia).
116A -> P (in Madrid; unstable). VAR_003038
117H -> L (in Vexin; increased oxygenaffinity).
117H -> Q (in Hafnia). VAR_003039
118H -> P (in Saitama; unstable). VAR_003040
118H -> R (in P-Galveston). VAR_003041
118H -> Y (in Tsukumi). VAR_025399
120G -> A (in Iowa). VAR_003042
121K -> E (in Hijiyama). VAR_003043
121K -> I (in Jianghua). VAR_003044
121K -> Q (in Takamatsu). VAR_003045
122E -> A (in D-Neath). VAR_003046
122E -> G (in St Francis). VAR_003047
122E -> K (in O-Arab). VAR_003049
122E -> Q (in D-Los Angeles/D-Punjab/D-Portugal/D-Chicago/D-Oak Ridge).
122E -> V (in D-Camperdown/Beograd). VAR_003050
124T -> I (in Villejuif; asymptomaticvariant).
125P -> Q (in Ty Gard; O(2) affinity up). VAR_003053
125P -> R (in Khartoum; unstable). VAR_003052
125P -> S (in Tunis). VAR_003054
127V -> A (in Beirut). VAR_003055
127V -> E (in Hofu; unstable). VAR_003057
127V -> G (in Dhonburi/Neapolis; unstable;beta-thalassemia).
128Q -> E (in Complutense). VAR_003058
128Q -> K (in Brest; unstable). VAR_003059
129A -> D (in J-Guantanamo; unstable). VAR_003060
130A -> P (in Crete; O(2) affinity up;unstable).
130A -> V (in La Desirade; O(2) affinitydown; unstable).
131Y -> D (in Wien; unstable). VAR_003063
131Y -> S (in Nevers). VAR_003064
132Q -> E (in Camden/Tokuchi/Motown). VAR_003065
132Q -> K (in Shelby/Leslie/Deaconess;unstable).
132Q -> P (in Shangai; unstable). VAR_003067
132Q -> R (in Sarrebourg; unstable). VAR_003068
133K -> N (in Yamagata; O(2) affinity down). VAR_003069
133K -> Q (in K-Woolwich). VAR_003070
134V -> L (in Extredemura). VAR_003071
135V -> E (in North Shore-Caracas;unstable).
136A -> E (in Beckman; O(2) affinity down;unstable).
136A -> P (in Altdorf; O(2) affinity up;unstable).
137G -> D (in Hope; O(2) affinity down;unstable).
139A -> P (in Brockton; unstable). VAR_003076
140N -> D (in Geelong; unstable). VAR_003077
140N -> K (in Hinsdale; O(2) affinity down). VAR_003078
140N -> S (in S-Wake; associated with V-6). VAR_025335
140N -> Y (in Aurora; O(2) affinity up). VAR_003079
141A -> D (in Himeji; unstable; O(2)affinity down).
141A -> T (in St Jacques: O(2) affinity up). VAR_003081
141A -> V (in Puttelange; polycythemia; O(2)affinity up).
142L -> R (in Olmsted; unstable). VAR_003083
143A -> D (in Ohio; O(2) affinity up). VAR_003084
144H -> D (in Rancho Mirage). VAR_003085
144H -> P (in Syracuse; O(2) affinity up). VAR_003087
144H -> Q (in Little Rock; O(2) affinityup).
144H -> R (in Abruzzo; O(2) affinity up). VAR_003088
145K -> E (in Mito; O(2) affinity up). VAR_003089
146Y -> C (in Rainier; O(2) affinity up). VAR_003090
146Y -> H (in Bethesda; O(2) affinity up). VAR_003091
147H -> D (in Hiroshima; O(2) affinity up). VAR_003092
147H -> L (in Cowtown; O(2) affinity up). VAR_003093
147H -> P (in York; O(2) affinity up). VAR_003094
147H -> Q (in Kodaira; O(2) affinity up). VAR_003095
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine; in variant Raleigh.---MVHLTP
---CCCCCH
5.21UniProtKB
Link
2N-linked (Glc) (glycation); in Hb A1c.---MVHLTP
---CCCCCH
5.21UniProtKB
Link
2N-pyruvate 2-iminyl-valine; in Hb A1b.---MVHLTP
---CCCCCH
5.21UniProtKB
Link
2none---MVHLTP
---CCCCCH
5.21HPRD
Link
5PhosphothreonineMVHLTPEEK
CCCCCHHHH
17.49HPRD
Link
5PhosphothreonineMVHLTPEEK
CCCCCHHHH
17.49Phosphositeplus
Link
9N-linked (Glc) (glycation)TPEEKSAVT
CHHHHHHHH
41.89HPRD
Link
9N-linked (Glc) (glycation).TPEEKSAVT
CHHHHHHHH
41.89UniProtKB
Link
10PhosphoserinePEEKSAVTA
HHHHHHHHH
31.11HPRD
Link
10PhosphoserinePEEKSAVTA
HHHHHHHHH
31.11Phosphositeplus
Link
18N-linked (Glc) (glycation).ALWGKVNVD
HHHHCCCHH
21.03UniProtKB
Link
18N6-acetyllysineALWGKVNVD
HHHHCCCHH
21.03Phosphositeplus
Link
36PhosphotyrosineLLVVYPWTQ
HHHHCHHHH
5.88Phosphositeplus
Link
45PhosphoserineRFFESFGDL
HHHHHHCCC
29.40HPRD
Link
45PhosphoserineRFFESFGDL
HHHHHHCCC
29.40Phosphositeplus
Link
50O-linked (GlcNAc)FGDLSTPDA
HCCCCCHHH
42.51Phosphositeplus
Link
50PhosphoserineFGDLSTPDA
HCCCCCHHH
42.51HPRD
Link
50PhosphoserineFGDLSTPDA
HCCCCCHHH
42.51Phosphositeplus
Link
67N-linked (Glc) (glycation)AHGKKVLGA
HHHHHHHHH
47.48HPRD
Link
67N-linked (Glc) (glycation).AHGKKVLGA
HHHHHHHHH
47.48UniProtKB
Link
73O-linked (GlcNAc)LGAFSDGLA
HHHHHHHHH
30.18Phosphositeplus
Link
73PhosphoserineLGAFSDGLA
HHHHHHHHH
30.18HPRD
Link
85O-linked (GlcNAc)NLKGTFATL
CHHHHHHHH
14.44Phosphositeplus
Link
94S-methylcysteineSELHCDKLH
HHHHHHHCC
8.46HPRD
Link
94S-nitrosocysteineSELHCDKLH
HHHHHHHCC
8.46dbSNO
Link
94S-nitrosocysteineSELHCDKLH
HHHHHHHCC
8.46HPRD
Link
94S-nitrosocysteine.SELHCDKLH
HHHHHHHCC
8.46UniProtKB
Link
121N-linked (Glc) (glycation)HHFGKEFTP
HHCCCCCCH
49.03HPRD
Link
121N-linked (Glc) (glycation).HHFGKEFTP
HHCCCCCCH
49.03UniProtKB
Link
131PhosphotyrosineVQAAYQKVV
HHHHHHHHH
16.34HPRD
Link
131PhosphotyrosineVQAAYQKVV
HHHHHHHHH
16.34PhosphoELM
Link
131PhosphotyrosineVQAAYQKVV
HHHHHHHHH
16.34Phosphositeplus
Link
131Phosphotyrosine.VQAAYQKVV
HHHHHHHHH
16.34UniProtKB
Link
145N-linked (Glc) (glycation).ALAHKYH
HHHHCCC
39.14UniProtKB
Link
145N6-acetyllysineALAHKYH
HHHHCCC
39.14HPRD
Link
145N6-acetyllysineALAHKYH
HHHHCCC
39.14Phosphositeplus
Link
146PhosphotyrosineLAHKYH
HHHCCC
11.68Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
HBB_HUMANphysical interactionDIP:44966EDIP9761903
SELT_HUMANphysical interactionEBI-734742
intact16169070
HPT_HUMANin vivoHPRD:00786HPRD7378053
HBB_HUMANin vitroHPRD:00786HPRD1512262
6726807
6644819
- top -

Disease Reference
Kegg disease
OMIM disease
140700Heinz body anemias (HEIBAN)
613985Beta-thalassemia (B-THAL)
603903Sickle cell anemia (SKCA)
603902Beta-thalassemia, dominant, inclusion body type (B-THALIB)
Drug Reference
DrugBank
DB00893Iron Dextran
- top -
Query failed : Got error 28 from storage engine
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed