Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  3-hydroxyacyl-CoA dehydrogenase type-2  

UniProtKB / Swiss-Prot ID :  HCD2_HUMAN

Gene Name (Synonyms) : 
HSD17B10, ERAB, HADH2, MRPP2, SCHAD, XH98G2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion. 

Protein Function :  Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD). 

Protein Sequence MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKD...
Predicted Secondary Structure CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEECCCCHHH...
Protein Variant
LocationDescription
122L -> V (in MHBD deficiency;dbSNP:rs28935476).
130R -> C (in MHBD deficiency;dbSNP:rs28935475).
247N -> S (in MHBD deficiency; intermediateenzyme activity).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAACR
---CCCCCC
12.08UniProtKB
Link
45PhosphoserineDLPNSGGEA
ECCHHHHHH
46.35Phosphositeplus
Link
52Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAQAKKLGN
HHHHHHCCC
36.13Phosphositeplus
Link
79Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LALAKGKFG
HHHHHHHHC
64.58Phosphositeplus
Link
99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AVASKTYNL
CCCCHHHCC
45.34Phosphositeplus
Link
153PhosphothreonineVIINTASVA
EEEEECHHH
15.20HPRD
Link
179PhosphothreonineIVGMTLPIA
HHHHHHHHH
24.37Phosphositeplus
Link
214S-nitrosocysteinePEKVCNFLA
CHHHHHHHH
4.40dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
A4_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
EBI-371703
EBI-371735
EBI-799
intact9338779
9338779
9338779
9338779
A4_HUMANin vivo
yeast 2-hybrid
HPRD:02223HPRD15087549
10371197
9338779
SCOT_HUMANENSP00000168216STRING
ECHP_HUMANENSP00000168216STRING
ADO_HUMANENSP00000168216STRING
THIL_HUMANENSP00000168216STRING
GABT_HUMANENSP00000168216STRING
A4_HUMANENSP00000168216STRING
THIM_HUMANENSP00000168216STRING
HMCS1_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
AACS_HUMANENSP00000168216STRING
ECHB_HUMANENSP00000168216STRING
THIK_HUMANENSP00000168216STRING
MMSA_HUMANENSP00000168216STRING
- top -

Disease Reference
Kegg disease
OMIM disease
3004382-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency)
300220Mental retardation, X-linked, syndromic, 10 (MRXS10)
300705Mental retardation, X-linked 17 (MRX17)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures