Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial  

UniProtKB / Swiss-Prot ID :  HCDH_HUMAN

Gene Name (Synonyms) : 
HADH, HAD, HADHSC, SCHAD  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion matrix. 

Protein Function :  Plays an essential role in the mitochondrial beta- oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA. 

Protein Sequence MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI...
Predicted Secondary Structure CCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH...
Protein Variant
LocationDescription
40A -> T (in HADH deficiency). VAR_024079
57D -> E (in HADH deficiency). VAR_024080
86L -> P (in dbSNP:rs4956145). VAR_026764
152Q -> H (in dbSNP:rs1051519). VAR_055701
258P -> L (in HHF4; loss of activity). VAR_024081
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
16PhosphoserineVSSSSTASA
CCCCCCCCC
29.91HPRD
Link-
17PhosphothreonineSSSSTASAS
CCCCCCCCC
26.95HPRD
Link
19PhosphoserineSSTASASAK
CCCCCCCCC
23.89HPRD
Link
73PhosphoserineGIEESLRKV
HHHHHHHHH
22.23HPRD
Link
73PhosphoserineGIEESLRKV
HHHHHHHHH
22.23Phosphositeplus
Link
87Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AENLKAGDE
CCCCCCCHH
63.00Phosphositeplus
Link
179N6-acetyllysineVPVMKLVEV
CCCCCEEEE
50.00HPRD
Link
179N6-acetyllysineVPVMKLVEV
CCCCCEEEE
50.00Phosphositeplus
Link
179N6-acetyllysine.VPVMKLVEV
CCCCCEEEE
50.00UniProtKB
Link
185N6-acetyllysineVEVIKTPMT
EEEECCCCC
52.32HPRD
Link
185N6-acetyllysineVEVIKTPMT
EEEECCCCC
52.32Phosphositeplus
Link
185N6-acetyllysine.VEVIKTPMT
EEEECCCCC
52.32UniProtKB
Link
202Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VDFSKALGK
HHHHHHHCC
47.85Phosphositeplus
Link
202N6-acetyllysineVDFSKALGK
HHHHHHHCC
47.85HPRD
Link
202N6-acetyllysineVDFSKALGK
HHHHHHHCC
47.85Phosphositeplus
Link
202N6-acetyllysine.VDFSKALGK
HHHHHHHCC
47.85UniProtKB
Link
226PhosphotyrosineLLVPYLMEA
HHHHHHHHH
15.94HPRD
Link
226PhosphotyrosineLLVPYLMEA
HHHHHHHHH
15.94Phosphositeplus
Link
241N6-acetyllysineGDASKEDID
CCCCHHHHH
62.21HPRD
Link
241N6-acetyllysineGDASKEDID
CCCCHHHHH
62.21Phosphositeplus
Link
241N6-acetyllysine.GDASKEDID
CCCCHHHHH
62.21UniProtKB
Link
264PhosphotyrosineELLDYVGLD
HHHHHHHHH
9.08HPRD
Link
312N6-acetyllysineEGFYKYK
CCCEECC
44.28HPRD
Link-
312N6-acetyllysineEGFYKYK
CCCEECC
44.28Phosphositeplus
Link-
312N6-acetyllysine.EGFYKYK
CCCEECC
44.28UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
HCDH_HUMANin vitroHPRD:08372HPRD10840044
11451959
10231530
- top -

Disease Reference
Kegg disease
OMIM disease
2315303-alpha-hydroxyacyl-CoA dehydrogenase deficiency (HADH deficiency)
609975Familial hyperinsulinemic hypoglycemia 4 (HHF4)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-179; LYS-185; LYS-202;LYS-241 AND LYS-312, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures