Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Host cell factor 1  

UniProtKB / Swiss-Prot ID :  HCFC1_MESAU

Gene Name (Synonyms) : 
HCFC1  

Species :  Mesocricetus auratus (Golden hamster). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). Note=HCFC1R1 modulates its subcellular localization and overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. Non-processed HCFC1 associates with chromatin. Colocalizes with CREB3 a 

Protein Function :  Involved in control of the cell cycle. Also antagonizes transactivation by ZBTB17 and GABP2; represses ZBTB17 activation of the p15(INK4b) promoter and inhibits its ability to recruit p300. Coactivator for EGR2 and GABP2. Tethers the chromatin modifying Set1/Ash2 histone H3 'Lys-4' methyltransferase (H3K4me) and Sin3 histone deacetylase (HDAC) complexes (involved in the activation and repression of transcription respectively) together. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. 

Protein Sequence MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWF...
Predicted Secondary Structure CCCCCCHHHHHHHCCCCCCEEECCCCCCCCCCCCCCEEEEECCEEEEEECCCCCCCCEEEEEECCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
794O-linked (Xyl...) (glycosaminoglycan)PGIKSPITI
CCCCCCCEE
21.44SysPTM
Link-
797O-linked (Xyl...) (keratan sulfate)KSPITIITT
CCCCEECCC
15.09SysPTM
Link-
800O-linked (Xyl...) (keratan sulfate)ITIITTKVM
CEECCCCEE
19.40SysPTM
Link-
801O-linked (Xyl...) (keratan sulfate)TIITTKVMT
EECCCCEEE
15.95SysPTM
Link-
805O-linked (Xyl...) (keratan sulfate)TKVMTSGTG
CCEEEECCC
27.30SysPTM
Link-
806O-linked (Xyl...) (glycosaminoglycan)KVMTSGTGA
CEEEECCCC
19.09SysPTM
Link-
808O-linked (Xyl...) (keratan sulfate)MTSGTGAPA
EEECCCCCC
29.91SysPTM
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures